FR:SCHNEIDER H TO:SHAFIR G S

Document Type: 
Document Number (FOIA) /ESDN (CREST): 
CIA-RDP91-00403R000201200016-5
Release Decision: 
RIF
Original Classification: 
S
Document Page Count: 
97
Document Creation Date: 
December 29, 2016
Document Release Date: 
August 14, 2005
Sequence Number: 
16
Case Number: 
Content Type: 
ABSTRACTS
File: 
AttachmentSize
PDF icon CIA-RDP91-00403R000201200016-5.pdf4.74 MB
Body: 
OO/OO/OOOOfVOO49 N---- Pp 0113-0116 TREATMENT IN VARfOUS MEDIA C. E. TR AN S 69 03 SCHNEIDERf H. //KERNFORSCHUNGSZENTRUM KARLSRUHE (F.R. GERMANY) --00/07 /19741 V----,, N----,, SPECTROCHEMICAL STUDY OF CORROSION OF DIFFUSION ZONES OF CORRODED CLADDING MATERIALS USING A GLOW DISCHARGE LAMP 46 PP ERDA EURFNR TR-1206 SCHNEIDERf H. //KERNFORSCRUNGSZENTRUM// 00/ 07 /19 7 4,, V ---- IN---- EXAMINATION OF CORROSI6N OR DIFFUSION ZONES IN CORRODED CANNING MATERIALS BY SPECTRAL ANALYSIS WITH USE OF A GLOW DISCHARGE TUBE BISI 13413 SCHNEIDER //SEEWIR~S`CH*AFT// 00100/1976,0008 N0012 PP 0752-0754 OPERATING PROBLEAS OF DISHING VESSELS *NTIS TT 77-5503312 B INST. FUER MATERIAL -UND FESTKOERPER FOR SCHUNG .SCHNEIDER H. //KERPIF;ASCHUNGSZENTRUM KARLSRUHE INST. FUER MATERIAL UND FESTKOERPERfORSCHUNG// 00/04/1976 V---- N ---- DETERMAIN4ION OFVARI'0US METALLIC AND NONMETALLIC IMPURTIES IN SODIUM METAL. 44 PP ERDA EURFNR-1346 SCHNEIDER, H. G. //ELEC.-ELEKTRONIKAI/ 0010011972f V00131f N ---- I PP 0506-0506 ,CHARACTERISTICS OF THIN FILM CAPACITORS -NTC 75-11818-09A -.-..---SCHNEIDER, HEIKE 11DIARIo DE LUANDA// 19/06/1976FV ---- IN---- PP 0011 INTERVIEW WITH OLIVER MAMBO INTERVIEW WITH ANC PRESIDENT OLIVER TAMBO, 6 PP JPRS 67596 SCHNEIDER,, K.. //STERNE UND WELTRAUM// 00/00/1975,, V ---- fN00111 PP 0357-0373 SATELLITE GEODESY 21 PP GUO PROPRIETARY INFORMATION REFER 07HER REQUEST TO DMAAC/RDSLL DHAAC-TC-2189 SCHNEIDER P. //GI ESSEk EI // 00/00/1973fV0060 N---- PP 0661-0669 THE VACUUM MOULDNG PR6CESS PRODUCTION OF MOULDS WITH UNBONDED SAND OISI 11905 SCHNEIDERf P. 00/00/1975 V00631N0003I Pp W3-0078 THE FOUNDR~ INDUS7RY IN BR AZ I L. *81SI 14299 000000067813 000000033903 000000067537 000000071 w 000000047113 000000052455 000000050330 000000029481 000000053444 SCHNEIDER, P. E. M. 000000004053 t/ZUR AOFALLSTOFFBELASTUNG VON GEWAESSERN UND ZUR ABWASSERREINIGUNG// 00/00/1974 V---- N---- PP 0053 O I ; WASTE-PROD CT PO LUTIO OF BODIES OF WATER --AND WASTE WATER PURIFICATION NASA TT F 15934 SCHNEIDER, U. 000000043568 //VEREINIGUNG ZUR FOERDERUNG DES DEUTSCHEN BRANDSCHUTZES ZEITSCHRIFT FUER FORSCHUNG UND TECHNIK IM BRANSCHUTZ// 00/00/1973 V---- N0003 PP 0100-0108 I ON THE EVWLUATIOh Of N ATURAL FIRES BY TESTING TO DIN 4102 NTC 75 11434-13L SCHNEIDERj, W. 000000016409 //ENERGIETECHNIKII 00/00/1967,V001? N0012 PP 0543-0546 SIMPLE NETHOS F4 S02 ~ND S03 DETERMINATION IN FLUE GASES NTC 74 13000-07B SCHNEIDER, W. 000000042109 //ENERGIE TECHNIK// 00/00/1974 00024IN00011 PP 0134-0137 , THE PRECALCULATI N OF ULFURIC ACID DEW POINT IN BROWN COAL DUST FIRINGS NTC 75 10719-13A SCHNEIDERSMANN, Eo 0. 000000065320 //STAHL UND EISEN// 00/00/1976 V0096,,NO012 PP 0584-0585 if i INVESTIGA ION ON THE S RVICE LIFE OF CRANE TRACK WHEELS 'BISI 14761 SCHNELL H 000000035702 //DEUT~Cfli ZAHNAERTILISCHE ZEITSCHRIFT// 00/0011974 V0029,.NO009 PP 0408-0410 ;A i DIURNAL V IATIONS IN n PHYSIOLOGICAL MOTILITY OF HUMAN TEETH *NASA TT F 16277 SCHNELLf H. 0GO000036162 //DEUTSCHE ZAHNAERTILISCHE ZEITSCHRIFTI/ 00/00/1974fvOO29 N0009 PP 0408-0410 A ~ DIURNAL VARIATI S IN HE PHYSIOLOGICAL MOTILITY OF HUMAN TEETH *NASA TT F 16277 SCHNELLf H. 000000032209 //DEUTSCHE ZAHNAERZTLICHE ZEITSCHRIFT// 00/09/1974fVO029 N0009 PP 0879-0880 A ~ DIURNAL VARIA71 S OF HE PHYSIOLOGICAL MOB ILITY OF HUMAN TEETH 7 PP NASA TT F 16277 SCHNELL JUERGEN 000000055070 //FREli ERDE// .28/06/1976fV---- N---- PP 0003 ' LEGISLATIVE ELE610N PR EPARATIONS CONTINUE,, NEUBRANDENMG BEZIRK LEGISLATURE'S WORK 2 PP JPRS 67948 SCHNEYOMAN YA. A. 000000040008 //ZAVODS&A LABORATORIYA// PP 0519-0520 DETERMINING THE CONCENTRATION OF ALCOHOL AND ETHER VAPORS IN EXHAUST ALCOHOL-ETHER MIXTURES WITH THE AID OF A ZEISS GAS INTERFEROMETER NASA TT F-16682 SCHNEZ01 H. 000000064384 //KERNFORSCHUNGSANLAGE JUELICH G.M.B.H. INSTITUT FUER CHEMISCHE TECHNOLOGIE// I V---- N ---- f 00/08/1974 1., ..TRITIUM IN REPROCESSING PLANT: A STUDY OF THE INVENTORY, BEHAVIORP AND THE POSSIBILITIES OF SEPARATION OF THE TRITIUM ISOTOPE 85 PP ERDA-GERHTR-139 SCHNIDERI W. 000000068053 //ARCH.-ARCHIV. FUER ELEKTRONIK UND UEBERTRAGUNGS TECHNIK// 00100/1975,?VO029 N0001 PP 0046-0050 CALCULATION OF TAE"IN~ERNAL" INDUCTANCE OF CYLINDRICAL CONDUCTORS OF ARBITRARY CROSS SECTION WITH RETURN PATH AT INFINITY AT DC. NTC 75-12875-09A SCHNIDTKE, WERNER 000000049658 -J/OLHYDRAULIK UND PNEUMATIKI/ 00/00/1975 V00190IN0003i, PP 0161-0164 THE ADVANiW3ES OF FLUIDIC CONTROL SYSTEMS AS OPPOSED TO OTHER TYPES OF CONTROL SYSTEMS DEMON STRATED IN THE LIGHT OF TECHNICAL AND ECONOMIC ASPECTS 13 PP GUO COPYRIGHT INFORMATION REFER OTHER REQUEST TO FSTC ARM/FSTC/AST-18401-062-75 SCHNIEDER, E. 00000G039 5 09 / / KER N F OR S CH UN6 SZ EN TR UM 00/0011974,V---- N---- THE SPECTR L ANAGSIS 6F CORROSION AND DIFFUSION IN CORRECTED SHEET MATERIAL USING A GLOW DISCHARGE LAMP *BISI 13413 SCHNIEDER, E. ON000031648 //KERNFORSCHUNG ZENTRUM// 0O/OO/1974fV----'.N ---- f THE SPECTRAL ANALYSIS OF CORROSION AND DIFFUSION IN CORRECTED SHEEL MATERIAL USING A GLOW DISCHARGE LAMP *BISI 13413 SCHNITZLER A. 000000021747 //KLINISiAE MONATSBLAETTER FUER AUGENHEILKUNDE// 00/00/197 it V0158,f N-- ' PP 0401-0403 LATE LESIONS DUE TO ~4TISONE TREATMENT --AFTER KERATOPLASTY NTC 75-10287-060 SCNKITZLER, E. 000000023892 //HOLZ ALS RIH-UND WERKSTOFF// N---- PP 0382-0389 NEW METHODS OF CAIP GL61NG NIC 74-13630-IIL $CHROESELENf, Re 000000061894 WNUMESIE ANALGESIE ET REANIMATION// 00100/1965 V062,KD004 P 0621-0631 PETHIDINE WH; ITS INfLPENCE ON PER- OPERATIVE HEMORRHAGE *ACSI K 6897 SCHOBER, E. ISCHMI ER UNG STECHNI K/ OCl/OOt197ljVOO02fNOOO9, PP 0282-0283 INVESTIGATION OF INTERACTIONS BETWEEN MECHANICALLY STRESSED METAL SURFACES AND GASES BY MEASN OF RADIOACTIVE LABELLING ERDIRFP/TRANS-174-76 SCHOCKI W. ----LIMAGNETIC FLUID DYNAMICSJ, CONFERENCE PROCEEDINGS// 00/02/1974fV ---- IN---- PP 0121 RAPIDLY EXPANDING CAR06N PLASMA JETS AS POTENTIAL LASING MEDIUM FSTC-1194-75 AST-17201-007-75 4 SCHOCK, W. //MAGNETIC FLUID DYNAMICS1 PROCEEDINGS OF CONFERENCE GDLR 26// 21/02/1974,V----,N --- ;6NPP 0121 RAPIDLY EXPANDING CAR PLASMA JETS AS POTENTIAL LASING MEDIUM f STC-AST-17201-007-75 000000042035 000000061304 000000061675 SCHODDE, R. 000000069622 //EMU// 00/00/1976,,VO076,N----,, PP 0161-0166 PART 4 INFRA-SPECIFIC VARIATION IN ALCEDO AZUREA LATHAM CSIRO 303 SCHODLI Ro ODOGOO049 024 //ERSTE MESSUNGEN MIT EINEM NEUEN OPTISCHEN STROMUNGSGESCHWINDIGKEITS-MESSVERFAHREN IM LAUFRADBEREICH VON TURBOVER DI CH TERN// 00/00/OM,V----.#N---- PP 0103-0125 FIRST MEASUREMENTS WITA A NEW OPTICAL FLOW MOCITY MEASURING TECHNIQUE IN THE ROTOR AREA OF TURBOCOMPRESSORS 23 PP FTD-I D(R S) 1 -0614-76 SCHODL, R. 000000055354 //DEUTSCHE 6ESELLSCHAFT FUER LUFT UND RAUMfAHRT// 00/00/1975 V --- PP 0103-0125 MR DLR-Mli'T 75- FIRST MEASUREMENTS WITH A NEW OPTICAL FLOW VELO CITY MEASUREMENT PROCESS IN THE ROTOR REGION OF TURBOCOMPRESSORS. 25 PP AIR/FTO-ID(RS)1-0614-76 ----UHOEMAN S J 000000068216 //AGROAIM'ALI~// 00/00/19751Y0007 N0003 PP 0073-0075 PHENOTYPIC RELAYlONSH3S BETWEEN IN THE NEUVAMM KARAKUL STUD SHEEP. *NTIS TT 76-58230 SCHOEMANf S. J. 000000041629 --IIAGRO IMALIA11 00/00/19751VO007fNO003 PP 0073-0075 PHENOTYPIC RELATIONSH3S BETWEEN RELATIVES IN THE NEUDAMM KARAKUL STUO SHEEP *NTIS TT 77-53049 SCHOENf H. 000000003797 //HOPPE-SEYLERS ZEITSCHRIFT FUER PHYSIOL OGISCHE CHEMIE// 00/00/1956 V0303 N---- PP 0081-0085 THE ELUTIO& CHR06TOGRWIC SEPARATION OF FREE AND ESTERIFIED CHOLESTEROL IN ORGAN AND SERUM FATS AND DIRECT COLORIMETRIC DETERMINATION RTC 74-12479-06A SCHOENAERS, F. //ANNALS. -ANNALES DE MEDECINE VETERINAIRE/t 00100/196101VO105 N0006 PP 0311-0316 AFRICAN SWINE F6ER MATOMERYS' DISEASE *NTIS TT 75 53162 SCHOENAERS,, F. I/ANNALS.-ANNALES DE MEDECINE VETERINAIRE// 00/00/19?5,,VO119 NOO06f PP 0411-0413 SWINE VESICULAR SISEASE - INFORMATION NOTE 3 PP ACSI K 6562 SCHOENBORN, H. //KLINIS E WOCHENSCHRIFT// OO/DO/19?01VO048 N --- ~f PP 0822-0824 CONSUMPTION COAGEOPA Hy IN At 2-DICHLORO- --ETHANE POISONING NTC 75-11525-06T SCHOEMBORNP He /IKLINISCHE WOCHENSCHRIFT// 00/00/19701VOD48 N ---- I PP 0822-0824 CONSUW71ON COAGEOPATHY IN At 2-DICHLORO- ETHANE POISONING NTC 75-11525-06T SCHOENE E. //ZEITSCHRIFT FUER PHYSIKALISCHE CHEMIE LEIP ZIG// OO/OO/1951,fVO197fNOOO3,p PP 0145-0160 ON THE DIFFUSION Of CADMIUM LEAD AND COPPER (1) IONS IN SILVER BROMIDE CRYSTALS ALSO NO 4 RTC 74-12435-07D 000000021947 000000057197 000000017912 000000032788 000000028674 SCHOENE E. 000000005628 //ZEITSCHRIFT FUER PHYSIKALISCHE CHEMIE LEIPZIG// 00/00/19511YO197,pNO003,0 PP 0145-0160 ON THE DIFFUSION OF CADMIUM LEAD AND COPPER (1) IONS IN SILVER BROMIDE CRYSTALS ALSO NO 4 NTC 74-12435-07D SCHOENEf H. K. 000000017622 //MARINE BIOLOGY// 00/0011974 V---- ND027 PP 0287-0298 ~EXPERIMENiAL INV'ESTIGWTIONS ON THE ECOLOGY OF THE MARINE *NTIS TT-75-58036 SCHOENEBUR6,, KARL-HEINZ I/NEUE JUSTIZ// 00/06/1976,,VD030,NO016,, PP 0475-0476 PROBLEMS OF SOCIALIST BASIC RIGHTS AND DUTIES DISCUSSEDt BASIC RIGHTS DEVELOPMENT IN SOCIALIST DEMOCRACY 9 PP JPRS 67993 SCHOENERTf K. //CHEM.- CHEMIE IKENIEUR TECHNIK// 000000061031 000000057845 00/00/1969 V0041 N---- Pp 0295-0300 ALSO NUMBE~S 5 AD 6 ' THE HEAT OF FORMATION OF FRACTURE IN IRON AND ITS DEPENDENCE ON THE RATE OF PROPAGATION PP 27 GUO.COPYRIGHT INFORMATION REFER OTHER REQUEST TO FTD/STINFO AIR /FTD-I D(R S) 1 -0486-76 SCHOENFELD R /I AUSTRIA C4EMICAL INSTITUTE PROCEEDING R11 00/00/1976PV0043 N0010 PP 039 CHEMI ST' S 6UI DE ~O THE' ECONOMI ST' S ENGLI SH CSIRO 218 SCHOENFELD R. //ROYAL ZSTRIALIAN CHEMICAL INSTITUTE PROCEEDINGS OF// 00/00/197601V0043 N0010p PP 0328 -CHEMIST'S GUIDE ~O THE ECONOMIST'S ENGLISH. CSIRO 218 -SCHOENFELDER, H. //INTERNATIONALE ELEKTRONISCHE RUNDSCHAU// 0010011973pVO027fNOOOlp PP 0001-0002 INFORMATION REDUCTION OR VIDEO SIGNALS NTC 74-11590-170 SCHOENFELDER 1 //CHEM. -CHE4IEiASERN (UND TEXTIL-ANWENDUNG- STECHIK UND ZEITSCHRIFT FUER DIE GESAMTE TEXTIL-INDUSTRIE) 00/00/ 19 74, v0024, N---- Pp 0572-0575 LIGHT WEATHER AND DECA RESISTANCE OF POLY ACRYLONITRILE FIBERS NTC 76-10036-11E SCHOENHERRf ALBRECHT //FRANKFURTER ALLGEMEINE// v---- P oom-0 13/05/19771 P 010 BISHOP ANALYZES, TATUS OF CHURCH IN RURAL AREAS 7 PP JPRS 69266 SCHOENMAKEER 0. D. 11RA&EX RUNDSCHAU// 00/00/1973f V---- tj--- PP 0528-0542 ELECTRIC FURNACE'6UTPUiT RAISED BY ORGANIZATIONAL AND OPERA71ONAL MEASURES He 9102 SCHOENMAKERf 0. D. //RADEX RUNDSCHAU// 00100/1973 PP 0543-0549 SUPPLEMENYOF THE R T Of ELECTRIC FURNACE OUTPUT RAISED BY ORGANIZATIONAL AND OPERATIONAL MEASURES H8 9103 SCHOENREIC"j K. //NAFTA// 00/00/19711V0027 N---- PP 0154-0157 INDICES OF OIL-BiARING'DEPOSITS AS BASED ON THE FORMATION WATERS OF POLAND NASA TT F 17101 SCHOENREIC14,p K. //NAFTA// 00/0011971,0027, N ---- PP 0154-0157 NUKOER 4-6 000000070044 000000074141 000000012191 000000067499 000000073631 000000029572 000000029573 000000060491 000000060510 INDICES OF OIL-BEARING DEPOSITS AS BASED ON THE FORMATION WATERS OF POLAND 9 PP NASA TT F 17101 SCHOENREICH, K, //NAFTA// 00/00/1971,0027,N--, PP 0154-0157 NO 4-6 INDICES OF OIL-BEARING DEPOSITS AS BASED ON THE FORMATION WATERS OF POLAND __LtNASA TT F-17101 SCHOEPF,. E. //HAUTARZT// 00/00/1972 V0023 N---;t PP 0295-0301 SIDE EFFEN OF iOPIC GLUCOCOR TI COI DS NTC 76-lOG79-060 SCHOEWE, EGBERT //DIE LEBENSMITTELINDUSTRIEl/ 00/09/1974 V--- N---- PP 0416-0418 DEVELOPMEN~ OF 4UIT, ~EG.ETABLE PROCESSING INDUSTRY TRACED 7 PP JPRS 63985 SCHOLL,, VON H. / /FR EQ UENZ / / 00/04/19631VO017 N0004 PP 0125-0133 OBJECTIVE PROCED E FOA DETERMINING AUDITORY AND MONITORING THRESHOLDS FSTC 1873-75 *FSTC AST-18101-024-75 SCHOLLj, VON W. //SONOERNEFT LANOW. FORSCHUNG// 00/00/1962,,VO01600N ---- Jf PP 0138-0147 NO E14GLISH TITLE TT 76-581G4 SCHOLZ,, E. //FORSTARCHIV// 00/00/1973 VDD44 N0008 PP 0171-0174 BIOCHEMICK METH60S IWFOREST GENETICS NRC C-1431? SCHOLZ IST'. WOR ARCHIM 00/00/1973,V0044 NOOOB PP 0171-0174 BIOCHEMI CAL METADS IWFOREST GENETICS NRC C-14319 SCHOLZf G. //FLORA// 00/00/19601VOI48 N---- Pp 0484-0488 ~THE TRANSLOCATIOh Of 86RON IN TOBACCO LEAF WITH DIVIDED ROOT SYSTEMS NTC 74-12298-02D SCHOLZ H. //DEVTSCHE IIERAERZTLICHE WOCHENSCHRIFT// 00/00/1973,,VD(P9 N ---- t Pp 0613- STUDIES ON THE 4THOGENESIS OF HYPO- MA6NESAEMIC TETANY, PART II, CHANGES IN CALCIUMf PHOSPHORUS, POTASSIUM AND SODIUM IN BLOOD AND CEREBROSPINAL FLUID IN HYPOMAGNESAEMIA 000000053972 000000065963 000000004391 000000022668 000000033685 0000000328 34 000000017957 000000005807 000000017949 OF SHEEP NTC 75-10713-02E sCHOLZ.. H. 000000032826 //DEUTSCHE TIERAERZTLICHE WOCHENSCHRIFT// 00/00/1973,VO079,N --- f PP 0613- STUDIES ON THE PATHOGENESIS OF HYPO- HAGNESAEMI C TETANY. PART Il. CHANGES IN CALCIUM PHOSPHORUS POTASSIUM AND SODIUM A f IN BLOOD D CEREeROSP NAL FLUID IN HYPOMAGNESAE MI OF SHEEP 14TC 75-10713-02E SC"oLZf KARLHEINZ 000000033963 //DIE WIRTSCHAFT// iO/12/1974f V ---- VNO025 PP 0006-0007 I PROGRESS OF FOUNDRY INDUSTRY DISCUSSED 5 PP JPRS 66653 SCHONAUER Wi A 000000061545 //DEUTSC E ORSCHUNGS- UND VERSUCHSANSTALT FUR LUFT- UND RAUMFAHRT INSTITUT FUR ANGEWANOTE MATHEMATIK UND MECHANIK// o0i001---- V ---- IN ---- I 0LR-F8 7441 NUMERICAL SOLUTION OF THE STEADY LAMINAR HYPERSONIC BOUNDARY LAYER EQUATIONS AT CHEMICAL NONEQUILIBRIUM ESA TT 229 SCHONAUER, V. 000000014085 POEUTSCHE LUFT-UND RAUMFAHRT FORSCHUNGSBERICHT 74-41// 00/00/1974,V---- N---- Pp OOdl -0077 6 NUMERICAL SOLUT1 N OF %E STEADY LAMINAR HYPERSONIC BOUNDARY LAYER EQUATIONS AT CHEMICAL NONEQUILIBRIUM 64 PP AIR/FTD/HC-23-1164-75 SCHONBECK, H. 000000069101 //SONDERDRUCK VERHANDLUNGEN DER GESELLSCHAFT FUR OKOLOGIE SAARBRUCKEN// N ---- .V--- 0O/00/1q?3 P 0435-0455 . ;t V METHODS OF INST LING EFFECTIVE REGISTER FOR AIR POLLUTION USING PLANT INDICATORS *NTIS TT 77-59166 SCHONEFELDf CH. 000000043995 .//MILITARTECHNIK// 00/00/1975d-- NO003, PP 0114-0116 i~ CUMULATION OF PLOSIVE CHARGES 9 PP AIR /FTo-IP(RS) 1-2191-75 SCHONERT, D. 000000012272 //STAHL UND EISEN// *N ---- IPP 1141-1148 00/00/1974f VO094 , WEAK POINTS IN R LLIWj KILL DRIVE SYSTEMS WHOSE MECHANISMS ME LIABLE TO VIBRATE 01 SI 130V SCHONERTe D. 000000021317 //STAHL UND EISEN// 00/00/1974 V0094fNOO23,f PP 1141-1148 M WEAK PO S IN ROLLING MILL DRIVE SYSTEMS WHOSE MECHANISMS ARE LIABLE TO VIBRATE Stu 13027 SCHOMERI,. D. 000000021154 //STML UND EISEN// 00/00/1974.,VO094fNO023f PP 1141-1148 WEAK POINTS IN ROLLING MILL DRIVE SYSTEMS WHOSE MECHANISMS ARE LIABLE TO VIBRATE BISI 13027 SCHONERT,. K. //DECHEMA-MONOGRAPHIEN// 00100/197?,,VO069,,N----,, PP 0027 MATHEMATICAL DESCRIPTION OF THE COMBINED "CONVECTION-DIFFUSION-REDUCTIOK' PROCESS BISI 13040 SCHONERT, VON K1. .//REPORT FROM DECHEMA-MONO GRAPHEIM// 00/00/19721V0069 N---- Pp 0000 MATHEMATICAL DES~RIPTI6N OF THE COMBINED COVECTION-DEFFUSIONIREDUCTION PROCESS *BISI 13040 SCHONESHOFER, M. -//ZEITSCHRIFT FUER NATURFORSCHUNG 8// 00/00/1972,o V00271f N---- PP 0649-0659 PULSE RADIOLYSIS STUDAS OF THE OXIDATION OF ASCORBIC ACID BY ON RADICAL AND HALIDE RADICAL ANION COMPLEXES IN AQUEOUS SOLUTION FSTC-HT-23-1314-73 SCHONES"OFER, M. //INTERNATIONAL JOURNAL OF RADIATION PHYSICS AND CHEMISTRY// 00/00/19731VOMIN---;~ PP 0375-0386 PULSE RADIOLYTIC INVE IGATION OF S4063-RADICAL AS INTERMEDIATE PRODUCT OF THIOSULPHATE OXYDATION AND TETRATHIONATE REDUCTION NTC 75-13227-07E SCHOOLER,, K. L. //DEUTSCHE MEDIZINISCHE WOCHENSCHRIFT// 00/00/1965fV--aND090 PP 0344-034-6 MEDICAL TASKS D INGG fkANSPORTATION OF THE SEVEREL INJURED IN HELICOPTERS *ASCI K 5384 SCHOOP J //STAL 6D EISEN// 00/00/1976fVO096 N0007f PP 0309-0315 INDUSTRIAL RESUM OF THE USE EMF MEASUREMENTS Of THE LD PROCESS. *BISI 14429 SCHOOPI J. //STAHL UND EISEN// 00/00/1976,0096,,N0007, PP 0309-0315 NUMBER 8 INDUSTRIAL RESULTS OF THE USE OF E.M.F. MEASUREMENTS IN THE LD PROCESS SISI 14429 S-CHOOP J. //STAL UND EISEN// 00/00119761VO076 N0007 FP 0309-0315 INDUSTRIAL RESULiS OF iHE USE OF EMF MEASUREMENTS OF THE LD PROCESS *BISI 14429 SCHOPEf NICKEL H //MILITAERTECHNIK// 00/00/19 7 4f V ---- IN0002, PP 0072-0073 000000035040 000000012256 000000006322 000000059913 000000005686 000000059160 000000067366 000000056146 000000047702 -RESULTS OF USING TEST EQUIPMENT FOR SPECIAL EQUIPMENT ON TANKS FSTC-HT-23-170-75 SCHOTP J. //V68 KRAFTNERKSTECHNIK// 00100/1973 V0053 N---- PP 0199-0203 FIRESIDE C6RROSIbN ON 'CONVECTION HEATING SURFACE IN BOILERS ITS PREVENTION BY CHOICE OF APPROPRIATE MATERIALS AND ITS INFLUENCE ON HEAT TRANSFER AND PRESSURE DROP NTC 74 12992-13A SCHOTTE.. K. //VERPACKUN6S-RUNDSCHAU// 00/00/1974p V ---- fN---- STERILIZED SHEETS FOR PRESERVED FOOD 23 PP GUO COPYRIGHT INFORMATION REFER OTHER REQUEST TO FSTC ARM/FSTC/AST-18001-004-75 SCHOTTEK, W. //CHEM.-CHEMISCHE TECHNIK// 00/00/19691VO021 N---- Pp 0708-0711 TOXICOLOGY OF VAYL CHIORIDE NTC 75-10843-061 SCHOTTEK, WOLFGANG //CHEM. -OiEMISCHE TECHNIK// 00/00/19591VO021,NO011, PP 0708-0711 NO ENGLISH TITLE *EPA TR 165-75 SCHOUPPEf A. //PALAEONTOGRAPHICA, SERIES A// 00/00/1974,0145,N---- PP CV9-0194 MORPHOGENESIS AND ORGAIZATION Of THE TABULATA WITH PARTICULAR REGARD TO THE FAVOSITIDA NRC C-16435 SCHRADER, H. //FORSCHUN6 AUF DEM GEBIETE DES INGENIER WESENS// 00/00/1961,VO017 N---- -SURFACES BY MEANIS OF 4RM AIR JETS FLOW PATTERN AND MASS TRANSFER fluo NASA TT 15167 SCHRAMM.. K. //KERNFORSCRUNGSZENTRUM KARLSRUHE INSTITUT FUR REAKTROENTWICKLUNG PROJEKT SCHNELLER BRUTER// 00/00/1975 V---- N---- -PROJECTS AINCIP'ES OF'LMGE SODIUM COOLED L OREEDER REACTORS *TIC ONWL-TR-147 SCHRAKM,, K. //KERNFORSCHUNGSZENTRUM KARLSRUHE// 12/M/1915,V ---- IN---- DESIGN PRINCIPLES OF L~ROE SODIUM-COOLED BREEDER REACTORS 56 PP ERD ONUL-TR-147 SCORVey H. 11SECOND SYMPOSIUM ON LOW POLLUTION POWER SYSTEMS DEVELOPMENT// 000000020389 000000049655 000000019880 000000007531 000000066598 000000023511 000000023445 000000071883 000000035199 00100/1974 V---- HYBRID DRI~E WITA-KIN6I( ENERGY STORE AS A VEHICLE POWER PLANT *TIC $CHRECKi H. //HYBRIDANTRIEB MIT KINETISCHEM ENERGIESPEICHER ALS FAHRZEUGANTRIEB// 00tll/1974 V---- N---- PAPER 29 AD SYMPOSIUM'LOW-POLLUTION (CONF-741151) HYBRID DRIVE WITH KINETIC ENERGY STORE AS VEHICLE DRIVE 17 PP ERDA/UCRL-TR-11018-76 N SCHREIBER,, Eo //HTM// 0OT00/1973fV----J*N0003f PP 0186-0199 RESIDUAL STRESS FORMATION DURING GRINDING Of HARDENED STEEL *91 SI 137- 83 SCHREIBER, F. K. //MEDIZINISCHE KLINIK// 00/00/19701VO065 N---- PP 1920-1923 DOXEPIN IN FUNCT ONAL EART COMPLAINTS AND OTHER ORGANIC DISEASES NTC 75-12182-060 SCHREIBER G., DR. //FEDERit MINISTRY OF DEFENCE MILITARY TECHNOLOGY RESEARCH REPORT// 00100/ODOP,, V ------N STUDIES FOR A SKIN-;;~~ECTIVE AGENT AGAINST HIULY TOXIC PHOSPHORIC ESTERS FSTC-AST-1009-75 SCHREIBER, HERMANN //DER SPIEGEL/l 14/0511973 V---- M0020 PP 0029-0032 ADVANCING SNE STEP AT ~ TIME 12 PP C50: 8120/0150 COMPLETED SPECIAL SCHREIBER, M. //DEUTSCHE GESUNDHEITSWESEN// 00/00/1975fV0030fN0017 PP 0811-0813 ON THE DIRECTED MONIT9ING OF STERILIZATION NASA TT F 16459 SCHREIeER I/DEUTSCAE"GOEHUNDHEITS WESEN// 00/00/19751V0030 N0017 PP 0311-0013 PRECISION CHECK 6F STEkILIZATION *NASA TT F 16459 SCHREIBER/ M. //DEUTSCHE GEHUNDHEITS~WESEN/l 00/00/19751VO030,,NO017 PP 0811-0813 PRECISION CHECK OF STEkILIZATION *NASA TT F-16459 SCHREIBER, ROLF //SOLDAT UND TECHNIK// 00/11/1976,,V ---- f N ---- If PP 0564-0568 THE NEW WEST GERMM ARMY 5-TONNE TRUCK 1? PP F STC-AST-1 1501 -036-77 SCHREIBER, S, //HARTEREI TECHNISCHE MIITEILUNGEN// 000000045441 000000040574 000000046178 000000052945 000000026269 000000029553 000000031858 000000015311 000000068823 000000045999 00/00/19731VO028,NO003 PP 0186-0199 RESIDUAL STRESS FORMATION OURING GRINDING OF HARDENED STEEL. BISI 13783 SCHREIeERI W. //TENSIDE DETERGENTS// .00/00/1972 NOW N0001 PP 0012-0017 EXPERIMENYS ON TAE CON~INUOUS DETERMINATION -OF WASHING EFFECT By EXTINCTION MEASUREMENTS ,:EON^ THE WASH-LIQUOR NTC 76-10210-11K SCHREIDER, A. V. //KORROZIYA I ZASHCHITA// OO/OOil973 V---- NO007,, PP 0007-0011 THE HYDR065 UPTIAKE OF STEEL DURING THE SERVICE LIFE OF OILFIELD EQUIPMENT IN ELECTROLYTES CONTAINING SULPHIDE *BISI 13248 SCHREINER R -//ZEITSCARIiT FUR ELEKTROCHEMIE// 00/00/1930..VO036,NO012 PP 0953-1040 ANODIC OXIDATION OF AHTIC ACID IN SULFURIC ACID SOLUTION 19 Pp AEC-ORNL-TR--2863 SCHREINER R //ZEITSiARIiT FUER ELEKTROCHEMIE// .00/00/1930,VG036,NG012, Pf 0953-1040 --ANODIC OXIDATION OF ACETIC ACID IN SULFURIC ACID SOLUTION 19 PP AEC-ORNL-TR-2863 SCHREINER RUDOLPH //ZEITSiARIFT ELEKTROCHEMIE// 00/00/1930..VO036IN0012, PP 0953-1040 ANODIC OXIDATION OF ACETIC ACID IN SULFURIC ACID SOLUTION AEC/ORNL /TR-2863-75 SCHREITMUELLER K. R. //DEUTSCHE F4SCHtMGS- UND VERSUCHSANSTALT FUER LUFT- UND RAUMFAHRT// 00/00/1973 V---- N---- REPORT DLR~FB 7~44 ESRO TT-71 NOMOGRAPH$ FOR GEOi~ATIONARY ORBITAL TRANSFER BY SOLAR-ELECTRIC PROPULSION RTC 75-11191-22A SCHREPFER, R. //DRUCK-PRINT// 00/00/1972,fVO109 N---- PP 0443-0444 VIBRATION AMP14 AND BETTING UP A PRINTING PRESS PIRA-1140 SCHRETZMANN,, 9. //KERNFORSCHUN65ZENTRUM KARLSRUHE// 0010311975f V ---- I u, ----f VAPOR PRESSURE OF OXID FUEL UNDER HYPOTHETICAL ACC40ENT CONDITIONS (3000 --- 5000 K) 10 PP ERDA-EVRFltR-lZ67 SCHREUDERS, 6. //DE WAAAHEID11 000000066271 000000033111 000000009476 000000026065 000000004060 000000042331 000000067204 000000064666 000000003053 05/08/1974 V---- N---- PP 0002 SOLZHENITS~N DE4NDS GiNERAL VLASOV IN HIS 'GULAG ARCHIPELAGO. 7 PP JFRS 62684 SCHREVEN, D. 000000030573 //TIJDSCHRIFT OVER PLANTENZIEKTEN// 00/00/19340 V00401 N-- 0097-0129 P P I EXTERNAL AND AND INTi; NA L SYMPTOMS OF BORON DEFICIENCY IN TOBACCO NTC 75-10175-0?D SCHREWE,, H. 000000062924 //IRSID-METALS SOCIETY CONTINUOUS CASTING CONFERENCE// 30105 /1976t V ---- IN ---- f ALSO 2 JUNE 1976 ROUNDS AS THE STARTING MATERIAL FOR SEAMLESS TUBES SISI 14576 SCHRODER,, H. J. 000000043598 //VGB; KRAFTWERKSTECHNIK// 00/00/1974 V0054,N-;~;, PP 0319-0324 i VG8 SPECIF CATIONS WATER AT NUCLEAR POWER STATIONS NTC 75 11438-18L SCHRODER J. iE 000000045579 //VDI RICHTE// - 00/00/1974 V- PP 0067-0072 0223 , ; ~0 ENERGY SijAAG THEFORM OF HEAT *81SI 13958 SCHRODER, JOHANN 000000007443 IMUMERISCHE MATHEMATIK// 00/00/1973 V0022 N---- PP 0037-0W ' A I REDUCTION ETHOO FOR D FFERENCE EQUATIONS IN BOUNDARY VALUE PROBLEMS I APL JHU T 2889 SCHRODERI P. 000000047748 //DEUTSCHE fORSCHUN6S-UND VERSUCHSAN TALT FUR LUFT-UND RAUMFAHRT INSTITUT FUR FLUGZEUGBAU BRUNSWICK// 00/11/1974,,V---- N---- ' THE BUCKLING, BEAVIOUR OF TRANSVERSE LOADED CIRCULAR CYLINDERS ESRO TT-105 SCHRODER, VON H. 000000067407 //PHARMIAIE// O0/0O/195?jVOO14lN----" PF 0329-0346 THE INFLUENCE OF NITROGEN PHOSPHORIC ACID AND' POTASSIUM ON THE YIELD AND.ESSENTIAL OIL CONTENT OF MARJORAM *NTIS TT 77-58044 SCHRODER,, VON H. 000000070677 //PHARMAZAIE// DO/-00/1959 V0014 N---- PP 0329-0346 ' ' k THE INFLUE E OF NITROG EN PHOSPHORIC ACID AND POTASSIUM ON THE YIELD AND ESSENTIAL OIL CONTENT Of MARJORAM NTIS-TT 77-58044 SCHRODER, VON H. 000000067 406 11PHARMAZIE11 00/00/1962t VOO171f N ---- t PP 0555-0564 COMPARATIVE INVESTIGATION ON THE INFLUENCE OF TIME OF HARVESTING ON YIELDS AND QUALITY IN THE PEPPERMINT VARIETIES *NTI 5 TT 77-58045 SCHROEDER, E. //PLASTE UND KAUTSCHUK// OO/OO/19?3,VOO20..N----J# PP 0241-0249 RELATIONS BETWEEN CHAIN-BRANCHING AND POLYMER PROPERTIES 74-12239-111 SCHROEDER, FRITZ-HELMUT //DETUSCHE ZEITSCHRIFT FUER PHILOSOPHIE// 00/09/1976,fVO024 N0009 PP 1069-1078 CLASS AND STRATA" DEVEL6PMENT IN SOCIALISM ANALYZED 12 PP JPRS 68242 SCHROEDER,. H. J. //VGB CHEMISTRY IN POWER STATION 1976/1 00/10/1976, V ---- fN ---- I 26/27 OCT MONITORING OF EMISSION AND GROUND LEVEL POLLUTION FROM NUCLEAR POWER STATIONS C.E. TRANS 7095 SCHROEDER, R. //GESELLSCHAfT FUER KERNFORSCHUNG KARLSRUHE INTERNATIONALE ATOMREATOBAU G.M.B.N. BENSBERG /KOELN// OD/06/1975pV---- N ---- COMMENTS ON THE STRODOCTION OF FAST BREEDERS IN THE DEBENELUX AREA. 283PP ERDA TR-159 SCHROEER,, W. //INTERNATIONALE ATOMREAKTORBAU GMBH// --00/07/1975f V SNA-2 RESEARC_ DE ELOPMENT PROGRAM. REPORT ON THE WORK CARRIED OUT DURING THE FOURTH QUARTER OF 1974 ON THE PROMOTION PROJECT R8 82 1 63 PP ERD INSFR-73 SCAROEER W. //INTERNATIONALE ATOMREAKTORBAU GMBH// 00/07/1975 V---- N---- SNR-2 RESEARCH AD DEAELOPMENT PROGRAM. REPORT ON THE WORK CARRIED OUT DURIW) THE SECOND QUARTER Of 1974 FOR THE PROMOTION PROJECT RB 82 1 ERD INBFR-71 SCHROEERf W. //INTERNATIONALE ATOMREAKTORBAU GMBH// 00/07/1975fV---- N---- SHR-2 RESE CH AD DEALOPMENT PROGRAM, REPORT ON THE WORK CARRIED OUT IN THE THIRD QUARTER OF 1974 ON INC PROMOTION PROJECT RB 82 1 37 PP ERD INBFR-72 SCHROER,. D. /IGLUECKAUF// voloo N----,, PP 1020-1022 ANHYDRIIE FOR SA K FILLING ROADWAY AR CHES NTC 75 10047-13C 000000006462 000000067091 000000058597 000000072645 000000071874 000000071872 000000071873 000000023834 SCHROETER,, E. H. /IASTRONOMISCHE 6ESELLSCHAFT MITTEILUNGENI/ 00/00/1973 V---- N00321 PP 0055-0064 SOLAR MAGNETIC FIELD MEASUREMENTS NTS 75-10010-038 SCHROETER EUGEN //BAUZEIIUNG// ---- PP 0116-0119 DETAILS PROVIDED ON 106/80 HOUSING CONSTRUCTION PLAN 9 PP JPRS 67305 SCHROETTER, E. //PHARMAZIE// 00/00119741V0029 N---- PP 0269-0273 SYNTHESIS OF 4 CALORA-ETHYLPHENOL BY CHLORINATION OF 2-ETHYLPHENOL NTC 74 13876-07C SCHlROfFj, A. M. //TECHNOLOGY OF THERMOELECTRONIC CONVERTERS STUDY DAYS ON THE NUCLEAR THERMOELECTRONIC GENERATORS MARSEILLE// 00/00100/1973rV---- N---- TECHROL06Y Of THERM6ELECTAONIC CONVERTERS STU&T DAYS ON THE NUCLEAR THERMOELECTRONIC 6ENERATORS MARSEILLE FSTC-HT-23-866-74 SCHROTH. H. //ZEITSCHRIFT FUER ANALYTISCHE CHEMIE// 00/00/1972,v0261 w---- Pp 0021-0029 QUANTITATIVE ANKYSIS 'Of VARIOUS MATERIALS BY LASER MICROSPECTROSCOPY NTc 75 12047-2ft 'SCHROTH H. //ZEIrSCHRIFT FUElt ANALYTISCHE CHEMIE// 00/00/1972 V0261,.NO001,f PP 0021-0029 QIUANTITATI~E MALYIS OF VARIOUS MATERIALS BY LASER MI CROSPECTROSCOPY ,NASA-TT-F-15891 000000030581 000000068488 000000046468 000000011076 000000045752 000000001653 SCHROTT A. 000000034206 //DEUTSCHE FORSCHUN6S- UND VERSUCHSANSTALT FUR LUFT- UNG RAUMFAHRT INSTITUT FUR FLUGFUNK UND MIKROWELLEN REPORT DLR-FB 73-112// 00/0011974 V---- N---- DEIERKINAO N OF'THE 4PARENT PHASE CENTRES OF AN AIRCRAFT ANTENNA FOR CALIBRATING THE INTERFEROMETFR OF THE GERMAN CENTRAL ERSO TT 115 SCHRUMPF, S. ~~- ~ /ANNALS. -ANNALES HYDROGRAPHIQUES/1 00/00/1974pV0002fN0741,, PP 0059 5TH,SERIES FASC. I ALSO PP 61-64 NORTH ATLMTlC OCEANOGRAPHIC MISSION (SEPTEMBER .1967-AU6UST 1969); SELECTIONS FROM 9 PP GUO COPYRIGHT INFORMATION REFER OTHER REQUEST TO DMAAC/RDSLL OMAAC-TC-2183 SCHRYVER, A. DE. //OUL.-OULLETIN DU CANCER// 00100/1975,fVO062 N0002,, PP 0175-0182 PREOPERATIVE RADIOTHERAPY IN BREAST CANCER OESCRIPTION OF A CLINICAL TRIAL PROTOCOL AND ITS PRELIMINARY RESULTS 000000061732 00000M5978 //WISSENSCHAFT Z D TECHN HOCHSCH KARL-MARX- STADT// 001--/1974 VOOl6rN0OO4 PROBLEMS WITH PLANAR TNBULENCE AMPLIFIERS FOR INDUSTRIAL CONTROLS *FSTC-IMIS 18401-006-77 SCRUEFFNER 000000010663 //DEUTSCHE$ ARCHIV FUER KLINISHCE MEDIZIN// 00/00/1899,FV0064 N---- PP 0428-0449 CONTRIBUTION TO i~E KN6WLEDGE FO MALARIA NTC 74-12700-06E SCHUELERf HANS 000000057327 /tZEIT DIE// 18/06/1676 V---- N---- PP 0014 DEVELOPMENiS ON 'LATEST'LEOPARD MODELS DISCUSSED 6 PP JPRS 67675 ,SCHUELER? KLAUS 000000072114 //NEUES DEUTSCHLAND// 30/10/1976 V---- N---- PP 0005 -ALSO 31 OCi 76 ' JOINT LMGUAGE RESEARCH LITERATURE DEVELOPMENTS -REPORTED, GDR-CSSR LIT9ATURE CONFERENCE 3 PP JPRS 68288 SCHUERER, GERHARD 000000041185 //PRESSE INFORMATIONEN// M-0003 03/1976 V 12-1 -USSR EtONOMItNI_NT_i6RpAPION'TO BE CONTINUED 5 PP GOR JPRS 67214 SCHUERMANN E. 000000071875 //*tH. - CHIV FUER OAS EISENHUETTENWESEN// 00/100/1959 V0030 N0002 PP 0103-0120 QUANTITATIOE TH&AL AALYSIS. POSSIBILITIES 16R EVALUATING THE QUANTITATIVE THERMAL ANALYSIS 0F BINARY SYSTEMS APPLIED TO ENTHALPY MEASURE- MENTS PERFORMED 0; LEAD/CADMIUM ALLOYS 58 PP ERD IS-TR-95 -..SCHUERMANN,, J. 000000059964 //GLUECKAUF// 00/00/19741VO110f N---- PP 0083-0069 MECHANISED SINKIN6 OF STAPLE PITS BY DISC REAMERS -PITC 75-13216-C03I SCHUETT, P. 000000017955 //ALLGEMEINE FORSTZEITSCHRIFT// 00/00/1973,00281N00111 PP 0210-0212 DIEBACK OF AUSTRIAN PINE IN BAVARIA (SAMC"ORSTIA PINEA (KARST.)V. HOHN) NRC C-14024 SCHUETTEf H. 000000052076 /IWASSERWIRTSCHAFT WASSERTECHNIK// 00/00/197Z VOOZ2 N---- PP 0365-0367 POSSIBILIYY OF VSING 4DROCYLONES FOR THE PURIFICATION Of FLUME AND WASH WATER FROM SUGAR FACTORIES. NTC 75-12773-138 SCHUETTEf H. 000000040264 //WASSERWIRTSCHAFT WASSERTECHNIK// 00100/1972 V0022IN --- ;~OPP 0365-0367 POSSIBILIT~ OF USING ROCYLONES FOR THE PURIFICATION OF FLUME AND WASH WATER FROM SUGAR FACTORIES. NTC 75-12~773-138 SCHUETTE H //WASSE;WRTSCHAFT WASSERTECHNIK// 00/00/ 197 2t V00221 N---- PP 0365-0367 -POSSIBILITY OF USING 4DROCYLONES FOR THE PURIFICATION OF FLUME AND WASH WATER FROM SUGAR FACTORIES. WU 75-12773-138 SCHUETTE.. H. R. !//I SOTOPENPRAXI S// 00/00/1971,rVO007 N---- PP 0330-0343 METABOLISM AND AHAVIOA OF RESIDES FROM THE PROPHAM IN SUGAR BEETS NX-74-13239-06A SCHUETZ //AKTENVERMERK TFS-A-28/74. ERWEITERUNG DER EISNATZZEIT VON F 104 6 FLU6ZEUGEN IN LUKE AFB// V--- N---- Pr 0001- 17/07/19741 f 10 0019 INCREASING THE SERVICE PERIOD OF F 104 G AIRCRAFT AT LUKE AFS 20 Pp AIRIFTD-HC-23-0632-7s SCHUETZ, J. //RADIOLOGIE// 00/00/19721VO012 NO009f PP 0294-0297 CAROTID ANGI06RWHY IN THE DIAGNOSIS OF PATIENTS WITH SKULL AND BRAIN INJURIES NNHC NO 1814 SCHUETZE, WALTER //EUROPA-ARCHIV// 00100/1976 V----,NO010 PP 0337-0346 POSSIBILlifES LIMITS 'F WESTERN EUROPEAN ARMAMENT COOPERATION &LORED Ii PP GUO JPRS L/6278 SCHUEZ, E. //JOURNAL FUER ORNITHOLOGIE// 00/10/1943"Val N0004 PP 0388-0405 OBSERVATIONS ON iHE S4NING OF STARLINGS IN 1943 IN THE ROSSITTEN BIRD SANCTUARY *NTIS TT 77-55051 ENHANUER W. //NEUE HUETTE'// 00/00/19750,VO020 N0007 PP 0417-04Z1 BASES, POSSIBILMES AD LIMITATIONS FOR NETALLOGRAPHIC ANALYES BY MEANS OD ELECTROCHEMICAL ISOLUTION Of DEPOSITS. 8151 14248 SCHUFFENHAUERf W. //NEUE HUETTE// 0010011975tV002010007 PP 0417-0421 OASESt POSS181LITIES 40 LIMATIONS FOR KEfA-LLOGRAPHIC,, ANALYSIS BY MEANS OF ELECTROCHEMIC ISOLATION OF DEPOSITS. 000000039836 000000028559 000000067707 000000035 27 3 00000M9399 0000000637 18 0000000510?2 000000059105 SCHULERJ We //SOLDAT UND TECHNIK// 00/10/1974 V---- N ---- I PP 0451-0453 EAST GERMA ARMY'MAINTENANCE POLICIES: PROPER USE AND MAINTENANCE OF WEAPONS SHAPE$ UNI FSTC-HT-23-1075-75 SCHULEW //NACHAI,CH.TENTECHNIK ELEKTRONIK// 00/0011974FV0024 N0012 PP 0468-0469 USE OF THE WAVE ALGORITHM FOR AUTOMATIC -----BOJECTION OF THE TOPOLOGY OF TWO-LAYER PRINTED CIRCUIT BOARDS AIR FTD-ID(RS)1-0203-76 SCRULEW G. //NACHkICHTENTECHNIK ELEKTRONIK// 00/00/197401VO024,NO012 PP 0468-0469 USE OF THE WAVE ALGORNM FOR AUTOMATIC PROJECTION OF THE TOPOLOGY OF TWO-LAYER PRINTED CIRCUIT BOARDS AIR FTD-ID(RS)I-0203-76 SCHULLER, He J. //DER MASCHINENSCHADEN// 00/00/19741VO047 N0001 PP 0001-0013 CRACKING IN THE WD R'EGION OF SHAPED COMPONENTS IN HOT STEAM LINES MATERIALS INVESTIGATIONS BISI 12477 SCHULLER, Me J. //DER MASCHINENSCH ADEN// 00/00/1974PV0047IN0002, PP 0069-0074 CRACKS IN THE WELDED SEAM RE610N OF SHAPED PARTS IN SUPERHEATED STEAM CONNECTIONS *BISI 13320 SCHULLERf He J. MER MASCHINENSCH ADEN// 00/00/1974 VDD47 NO0021 PP 0069-0074 CRACKS IN ~iE WEIDED SEAM REGION OF SHAPED PARTS IN SUPERHEATED STEAM CONNECTIONS BISI 13320 SCHULLER, He J. MER MASCHINENSCH ADEN// - 00/00/1974tVOD47 m00021 PP 0069-0074 CRACKS IN THE WEIDED SEAM REGION OF SHAPED PARTS IN SUPERHEATED STEAM CONNECTIONS *BISI 13320 SCHULLER Me J. //DER WASCHI NEN SCH ADEN// 00/00/1974.#VO047 ND0021 PP 0069-0074 CRACKS IN THE VI~INITY OF WELDS OF FITTINGS, FROM SUPERHEATED STEAM LINES C. E. TRANS 6587 -------SCHULLER,, He J. //VGB KRAFTWERKSTRECHNIK// 00/00/1974fVM4,.NO005 PP 0344-0357 CRACKS IN THE WELD REGfON OF FITTINGS -fROM SUPERHEATED STEAM PIPES MATERIAL INVESTIGATIONS BISI 12543 000000030852 000000047163 000000049185 000000011040 000000033210 000000021396 0000A16713 000000005865 000000023336 SCHULLER He J. I 000000050463 //MASCR NENSCHADEN// 00/00/1975 11 V0048 N0005 PP 0168-0176 ' DAMAGE TO SUPERH~ATED STEAM LINES C - E. TR 69 28 SCHULTf Re 000000042497 //ALLGEMEINE VERMESSLWGS-NACHRICHTEN// 00 /08 / 19 7 41? V---- NOOOS PP 0304-0311 i A A SYSTEM Of DI6I AL TE RAIN MODELS GUO DMAAC-TC-2066 SCHULTE-iiILLENP J. 000000065547 //DEUTSCHE FORSCHUNGS UND VERSUCHSANSTALT FUER LUFT UND RAUMFAHRT// -00/00t1973 V---- N---- REPORT DLR~FB 73q4 COST ACCOUNTING AT LARGE RESEARCH CENTRES 14TC 76-10290-05A SCHULTE, F. 000000064087 //VERfAHRENSTECHNIK/I 00/00/1976fVO010 N0005f PP 0252-0257 ULTRAFINE GRADIA MADE EXTREMELY ECONOMICAL BY MICRON SEPARATOR BISI 15227 SCHULTENJ 60 000000007484 /IARCH.-ARCHIV DER ELEKTRISCHEN UEBERTRAGUNG// 00/00/19601V0014 N---- PP 0163-0166 P A MEASUREMENT OF 7 E PRO ERTIES OF DIELECTRIC WAVEGUIDES AT MILIMETER WAVELENGTHS IN A RESONAT OR WITH OPTICAL~-TYPE COUPLING NTC 74-11602,20C SCHULTEN, Me Re 000000037725 //MESSTECHNIK// 00/00/1973 V0081IN0004 PP 0121-0122 ik V HIGH TEMP ATURE ACTI ATION OF FIELD ANODES FOR MASS SPECTROMETRY NTC 75 1120?-07D StHULTEN, Re " 000000005352 /A. I. Me SYMPOSIUM ON POWER STATIONS// 00/00/1974r HIGH TEMPERATURE REACTORS FOR NUCLEAR ENERGY AND RAW MATERIALS SUPPLY C. E. TRANS 6609 SCHULTEN., R. 000000064195 "VEREIN DEUTSCHER INGENIEURE BERICHTE// 00/0011974 V0224 N ---- I PP 0025-0035 I CLOSED CIR CUIT EhERGY SUPPLY 18 PP Ef(D-A LIO-TR-554 SCHULTHEISZ, EMIL 000000034780 l1MA6YAR HIRLAP11 , V ---- fN ---- I PP 0005 3 0103 /19 7 5 , MINISTER DISCUSSES PROGRESS , PROBLEMS IN MEDICAL , CARE 5 PP JPRS 64672 SCHULTZ -WALZ A. ~ 000000030622 //0FERSERE TUNGS-TECHINIV/ 00/00/1974fVOOllfN ---- f PP 0636-0639 LAYOUT OF OXIAL AND RO ARY VIBRATING CENTRIFUGES WITHOUT REGARD TO PROCESS ENGINNERING *BISI 13125 SCHULTZ,, f. //AGRONOMIE TROPICALE/1 01)/00/19741VO024IN0006 PP 0493-0504 UREA, 81URET AND THEIA COMBINATION AS NITROGEN SUPPLMENTS F6 SHEEP NTIS TT 76-53829 -SCHULTZt E. W. /IBAUTECHNIK, DIE// OOtO0/19?51VOO52 N0002 PP 0037-0042 USE OF SOIL STABEIZATION IN THE CONSTRUCTION OF TH FRANKFURT/MAIN RAPID TRANSIT LINE 17 PP ACSI K-6774 SCHULTZ, E. W. if/BAUTECHItIK, DIE// 00100/1975fVOO52 N0002 PP 0037-0042 EMPLOYMENT OF SOH STAILIZATION IN THE BUILDING OF THE H16H-SPEED RAILWAY IN FRANKFURT A MAIN *A.CSI K-6774 SCHULIZI H. J. //ARCH.-ARCHIV FUER DAS EISENHUETTENWESEN// 00/00/19741VO045..NO0051 PP 0279-0285 PERMEABILITY BEHAVIOUR OF FORMED COKE-ORE AND LUMP COKE-ORE SYSTEMS BISI 13193 SCHULTZf H. J. //MCH,-ARCHIV FUER OAS EISENHUETTEN5ESENI/ 00/00/1974 V00451NOW, PP 0445-0448 PRESSURE AOP, IN COKE SINTER LAYERS AND MIXTURES *BISI 14737 SCHULTZ, H. J. "ARCH.-ARCHIV FUER DAS EISENHUTTENWESEN// 00/00/1974 V0045tNO007, PP 0445-0448 PRESSURE AOP IN COKE SINTER LAYERS AND MIXTURES SISI 14737 SCHULTZ, H. J. IIAR CH.-ARCHIV FUfR DAS EISENHUTTENWESEN/1 O0/O0/19?41V0054,,N0OO5,, PP 0279-0285 PERMEABILITY BEHAVIOUR OF FORMED COKI-ORE AND LUVIP COKE-ORE SYSTEMS BISI 13193 SCHULTZ, H. J. 7/6LUCKAUF// 00/00/1974 V0110fNOC113f PP 0517-0522 SHAPE-DEP6DENT PROPERTIES OF BRIQUETTES SISI 13043 SCHULTZf 1. _..,_,__O//KOSMIC14ESKAYA BIOLOGIYA I AVIAKOSVICHESKAYA MEDITSINA// O/--/1976jV0O1O,,N0OO6f PP 0054-0057 NOV-DEC 76 IMPORTANCE OF NONVERBAL CHARACTERISTICS OF SPEECH 516NALS FOR EVALUATING THE PSYCHIC AND PHYSICAL CONDITION OF AN AIRMAN 6 PP JPR5 L/6859 000000056929 000000062962 000000066112 000000047417 000000066728 000000065240 000000051141 000000024584 0000OM3434 SCHULTZ, K. J. //DEUTSCHE FORSCHUNGS- UND VERSUCHSANSTALT FUER LUFT- UND RAUMFAHRT REPORT DLR-FB 73-11// ON 00/ 19 ? % V ---- IN---- INVESTIGATION OF THE C6MBINED HEAT AND MASS TRANSFER ON A WETTED FLAT PLATE IN PARALLEL FLOW AND WITH TURBULENT BOUNDARY LAYER NTE 74-13583-ZOM ON LOAN SCHULTZ E-PETZOLD, H. /IBUL.-BULLETIN OFFICE INTERNATIONAL EPIZOOTIES// 00/00/1963 V0059 N---- PP 1861-0165 NUMBER lIZ12 PREVENTIVE MEASURES IN FEDERAL REPUBLIC OF GERMANY AGAINST THE INTRODUCTION OF IMPORTANT EXOTIC EPIZOOTIC DISEASE *NTIS TT 76-53163 SCHULZ -BOEDEKER D. F. //NEUE VERPAC&G// 001/00/1973,VO026,N--- PP 1802-1805 QUALITY AND CONVENIEN~i DECIDE SALES SUCCESS -kRA-1000 SCHULZ-WALZ, A. //AUFSERETUNGS-TECHNIK// 00/00/1974f V---- N0004 PP 0339-0343 LAYOUT OF AXIAL VD R6~ARY VIBRATING CENTRIFUGES WITH REGARD TO PROCESS ENGINEERING SISI 13125 SCHULZ -W ALZ A. //AUFBERET6N6S-TECHNIK// 00/00/1974 V---- NM PP 0339-0343 LAYOUT OF VIAL VD ROiARY VIBRATING CENTRIFUGES WIT14 REGARD TO PROCESS ENGINEERING BISI 13125 SCHULZf D. //VIRCHOWS ARCHIV,, ABTEILUNG A. PATHOLOGISCHE ANATOMIE// 00/00/1973fVO358 N---- PP 0273-0280 CONTRIBUTION TO i~E GEhERAL PATHOLOGY OF ENDOCARDIAL REACTIONS. TOXIC ENDOCARDIAL CHANGES IN LOWER VERTEBRATES (CARP) NTC 75-11845-06C SCHULZ, E. //ABHANDLUNriEN ZENTRALES GEOLOGISCHES INSTITUT// 00/00/1965,V--;? N0001~HPP 0257-0287 SPORAE DISPERS FROM E TRIASSIC OF THURINGIA NTC 75-10242-OBG S CH ULZ EBERHARD //WAS~ERWIRTSCHAFT-WASSERTECHNIK// 00/04/1974 V --- ;IN --- ;~ PP 0126-0129 WATER SUPPLY., W STE W ER PURIFICATION MEASURES IN MAGDEBURG BEZIRK 6 PP JPRS 62469 SCHULZ, EBERHARD //EUROPA-ARCHIV// 00/00/19751V---- N0012 PP 0383-0391 MOSCOW'S ATTITUA TOWW 0 WEST EUROPEAN INTEGRATION ASSESSED 8 PP CSO: 8120/0132-76 COMPLETED SPECIAL 000000026284 000000035002 000000048196 000000036692 000000019065 000000035532 000000009 460 000000000692 000000024850 SCHULZ, 6 000000061544 //OEUTSC;E FORSCHUNGS- UNO VERSUCHSANSTALT FUR LUFT- UND RAUMFAHRT ZENTRALAOTEI LUNG NEID~RGESCH WINDIGKEITS-WINDKANALE// ooloo/ ---- Iv---- DLR-FB 74-46 CORRECTIONS IN SUBSONIC WIND TUNNELS WITH OULDY MODELS AND WITH GROUND SIMULATION ESA TT 218 SCHULZ,, G. //DEUTSCHE FORSCHUNGS- UND VERSUCHSANSTALT FUR LUFT- UND RAUMFAHRT INSTITUT FUR DYNAMIK DER FLUGSYSTEME// 00/00/OODOIV---- REPORT NO. DLR-4-75-5~ MAXIMUM LI KELIHOOD IDENTIFICATION USING 'KALMAN FILTERING -LEAST SQUARES ESTIMATION ESA TT-258 SCHULZ, G. //UEBERLEGUNGEN ZUM PROJEKT EINES AEROAKUSTIK-WINDKANALS, REPORT DLR-MITT-74-27// 00/00/1974/V ---- IN ---- I PP 0001-0018 CONSIDERATIONS FOR THE PROJECT OF AN AEROACOUSTICAL WIND TUNNEL NASA-TT-F-16508 SC"ULZf 6. FORSCHUNGSBERICHT 75-08// //DEUTSCHE LUFT- UND RAUMFAHRT., 00/00/1975 V- N----,. PP 0001-0044 AERO-ACOUi~IC_WUDS Of MICROPHONES FOR SOUND MEASUREMENT AND LOCATION IN FLOW FIELDS 41 PP AIRIFID-ID(RS)I-1533-75 000000059522 000000018532 000000014076 SC]HULZ, GER14ARD 1- f 000000014067 //DEUTSCHE FORSCHUNGS- UND VERSUCHSANSTALT FUER LUFT- UND RAUMFART, POR UEBERLEGUNGEN ZUM PROJEKT EINES AEROAKUSTIK-WINKANALS// QO/00/1974 V---- N----, PP 0001-0018 DLR-MITT A-27 ENGLISH TITLE UNKNOWN *NASA TT F 16508 SCHULZ GERHARD 000000022431 //BERtINER ZEITUNG// 12/12/1975 V ---- 4N----, PP 0003 MORE 6DR 4BLIC ACT O T T T T E I N REA O H USSRf Y WI PRACTICAL INTERPRETATION 1 PP JPRS 66774 SCHULzf H. 000000020467 //ERDOEL-UND-KOHLE-ERDGAS-PE7ROCHEMIE VEREINIGT MIT BRENNSTOFFCHEMIE// ,V0025 N---- PP 0014-0021 00/00/1972 SULPHUR COMPOUNDS IN PiTROLEUM AND PETROLEUM PRODUCTS NTC. 74 13182-210 -DIETER SCHULZ HANS iA 000000064266 , //AR .-ARCHIV. DEUTSCHLAND// 0010211977fvoolofNG0021 PP,,0126-0130 OASIC CHANGE$ IN LPG' S ANALYZED 7 PP JPRS 69004 SCHULZI JOACHIM 000000001811 //NEUE JUSTIZ/t 00/07/1974 V0028 N001410 PP 0433-0436 i' S _6DR SOClE lES DI CUSS LAW OF THE SEA PROBLEMS JPR$ 62941 SCHULZ/ M. 000000043607 //KAISTALL UND TECHNIK// --00/00/1973,V 0008 N ---- e PP 1421-1438 ~ STRUCTURAL DEFEC RESEARCH GAAS SINGLE CRYSTAL WITH THE AID OF THEIR MICROSCOPE NTC 75 11453-20L SCHULZ M. A 000000058562 //ST L UND EISEN// 00/00/1976 V0096 Nooll, PP 0531-0533 A ~ AN INTEREF ROMET IC MEASURING METHOD TO DETER14INE THE SELECTION OF ROLLED STOCK. BISI 14715 SCHULZ M. E. 00000007 0690 //MILWISSENSCHAFT// 0010011970f V00251 N ---- f PP 0285-0295 TECHNOLOGICAL ASPECTS OF WHEY PROCESSING NTC 76-13349-02A SCHULzf P. 000000000502 //DLR-MI7T-70-12// 00/11/1970fV---- N---- PP 0000 ON THE QUESTION 6F PILOT DETERIORATION DURING LOW ALTITUDE FLIGHT NASA-TT-F-15799 SCHULZJ. W. 000000036627 //DIE PHARMAZIE// 00/08/1975 V0030 N0008 PP 0498-0506 ii 64 & POTENTIAL ANSP T F MS OF NITROGEN MUSTARD 25 P JPRS 66797 SCHULZ W. A 000000066702 IIST L UND EISEN// 00/00/1976 V0096,,NG011, PP 0531-0533 ii AN INTER f ROMETRI C MEASURING METHOD TO DETERMIN E THE SELECTION OF ROLLED STOCK *eISI 14715 SCHULZ ZBIGNIEW , 000000049 269 //GOS PODARKA PLANOWA// 00/0511976 V---- N0005 PP 0266-0271 ' ECONOMIC J6URNAL REVIE4s EMPLOYMENT POLICY 12 PP JPRS 67726 -SCHULZE, A. 000000075464 //MILITARTECHNIKt/ 00/00/1975 eV NOOD5 PP 0216-0218 l PART 1p ALSO PARi Il i6. 6 PP 259-261 THE WG-7500 GENERATOR COMBINED WITH THE RN-10 VOLTAGE REGULATOR A NEW TANK POWER SUPPLY SYSTEM WITH NEW DESIGN FEATURES 13 PP GUO COPYRIGHT INFO REFER OTHER REQUEST TO FSTC ARM/FSTC/AST 18601-005-76 SCHULZE, A. COL. 00000005 2917 //MIL17AERTECHNIK// 00/09/1975 V---- N---- 4-0396 , PP 039 , . ALSO PAGE ~20 A NAVIGATION INSTRUMENT FOR ARMORED VEHICLES UTILIZIN6 A NEW OPERATING PRINCIPLE FSTC-AST-17001-016-75 SCHULZE, 0, 000000072457 //HEILBERUFE DIE// y 00/10/1975 1V 027fN0Ol0j PP 0295-0298 CARCINOGENS IN OUR ENVIRONMENT SCHULZE0 D. //KERNFORSCHUNGSZENTRUM KARLSRUHE// 00/00/1974tv ---- fN---- MECHANICAL EXCITATON ON SUPER CONDUCTING HELIX RESONATORS BY EXTERNAL SOURCES WITH SLOWLY VARYING FREQUENCY NTC'74 12900-20G SCHULZE, H. J /IZEITSCHRIF~ FUER PHYSIKALISCHE CHEMIE// 00100/1972,VO251 N---- PP 0145-0151 -THE EOUILI IUM i~ICKASS OF VERY THIN LIQUID FILMS ON QUARTZ SURFACES ~NTC 76-10201-07D SCHULZE, H. J //ZEITSCHRIFi FUER PHYSIKALISCHE CHEMIE// 00/00/1972.. V025 If N---- PP 0252-0268 INVESTIGATION OF THE E6UILIBRIUM THICKNESS OF THIN AQUEOUS LIQUID FILMS BETWEEN AIR-BUBBLES AND 6UARTZ SURFACES AS A FUNCTION OF THE ELECTROSTATIC INTERACTIVE FORCES NTC 76-10202-07D SCHULZE, HANS-GUENTHER //EIWEIT// 00/12/1975fV0030fN---- PP 1422-1425 TRANSITION TO INDUSTOL PRODUCTION METHODS IN AGRICULTURE ASSESSED 7 PP JPR S :667 59 SCHULZE ING G. //nASZAINENBAUTECHNIK// 00/00/1975,#V ---- PP 0379-0381 NEW METALWORKING MACHINES DESCRIBED 6 PP JPRS, 65893 000000020446 000000066578 000000066579 000000022058 000000029096 SCHULIE,, K-W. 000000044985 //MIEEEILUNGEN DES SONDER-FORSCHUNGSBEREICHS 79 FUER WASSERFORSCHUNG IM KUESTENBEREICH DER TECHNISCHEN UNIVERSITAET HANNOVER// 00/00/1973,f V---~ NOW11 A PROBLEM-ORIEN ED LANGUAGE FOR DYNAMIC FLOW IN OPEN-CHANNELS 144 PP *WTIS TT 76-58150 SCHULZEI P. 000000053036 //ARCH.-ARCHIV FUER EXPERIMENTELLE VETERINAERMEDIZIN MED// 00/00/1975,,V0029 N0001 PP 0121-0127 fLECTRON MICROSC6PE WRESENTATION OF -FleRILLAR STRUCTURES FROM FMD VIRUS. *NTIS TT 76-53670 P. //ARCH.-ARCHIV FUER EXPERIMENTELLE VETERINAERMEDIZIN MED// 00/00/1975,0029,0003 PP 0411-0425 ELECTRON 141CROSCOPE RDIES OF THE PROLIFERATION Of FMD VIRUS IN.CELLS CULTURES. *NTIS TT 76-53669 SCHULZE, P. IIARCH.-ARCHIV FUER EXPERIMENTELLE VETERINAERMEDIZIN MEW -00/00/1975,0029 N0003 PP 0427-0239 ELECTRON $41CROSC6PIC SSUDIES OF THE MULTIPLICATION Of fMD VIRUS IN CELL CULTURES. *NTIS TT 76-53662- 000000053035 000000053032 SCHULZEr P. //ARCH.-ARCHIV FUER EXPERIMENTELLE VETERINAERMEDIZIN MED// 00/00/1975 V0029 N0003 PP 0441-0457 ELECTRON MICROSC6PE ST60IES OF THE PROLIFERATION OF fMD IN VIRUS IN CELL CULTURES. III *NTIS TT 76-53671 SCHUMACHERo E. - //HELVETICA CHIMICA ACTA// 00/00/1953 V0036 N---- PP 0949-0961 THE THERMit DIFFbSION 'COLUMN. X. ON THE THEORY OF QUANTITATIVE SEPARATION OF GAS MIXTURES 15 PP ERDA-MLM-TR-2236 SCHUMMNI He //CHEM. -CHEMI SCHe BERI CHTE// 00/00/1973.#VO106010---- PP 2049-2057 PENTACAR BONY L(ORGANOM6AL TELLURIDE) CHROMIUM -MOLYBDENUM AND -TUNGSTEN COMPLEXES NTC 74-1~465-07C SCHUMANN, HANS //DEUTSCHE AUSSENPOLITIK// 00/10/1975.,V0020,,N0010,. PP 1468-1477 BLOC POSITION ON DISARMAMENT, NONPROLITERATION ANALYZED.. NONPROLIFERATION ONLY ONE PART OF PROBLEMS 8 PP JPRS 66556 SCHUMPELICKf V. //BEITRAEGE ZtR KLINISCHEN CHIRURGIE// 00/00/19741V0221 N---- PP 0431-0444 PRIMARY GASTRIC tARCOMIA _NTC 75-11656-06E SCHURMANN E. //ARCH.-~RCHIV FUER DAS EISENHUETTENWESEN// 00/00/19730,VD044IM0010, PP 0761-0768 MANUFACTURE OF LOW-CARBON STAILNESS AUSTENITIC C"ROKIUM-KICKEL STEELS USING THE ARGON- OXYGEN DECARKIRIZATION PROCESS BISI 11952 SCHURNARN,, F. We //ZEITSCHRIFT FUER ZELLFORSCHUNG// 00/00/1969..V0095 N-;-;~ PP 0223-0248 IRE ANTENNAL LOBi 0 E DEUTOCERBRUM IN LOCUSTA MIGRATORIA *NTIS TT 77-58050 SCHURMANNp Fo We //ZEITSCHRIFT FUR ZELLFORSCHUNG/1 00/00/1969fVO095 N --- ~ PP 0223-0248 THE ANTENNAL LOSi OF HE DEUTOCERORUM IN LOCUSTA ml CA ATOR I A *NTIS IT 77-58050 SCHlUAMmNf if //ELEC.-ELEKTRONISCHE RECHENANLAGEN// 00/00/1971 V0013 N---- PP 0250-0260 ON THE AAOMATIC'CONSTAUCTION OF NON-LINEAR PATTERN CLASSIfIERS FOR HANDPRINTING REC06NITION *NTC -76-10281-(0o 000000053037 0000000509 27 000000009812 000000027454 00000OG40706 000000020198 000000070706 000000067401 000000067466 SCHURMANNI YE. /tARCH.-ARCHIV FUER DAS EISENHUTTENWESENI/ 00/00/1975PV0046 N0003 PP 0195-0200 CONSIDERAT ONS 0; THE iRANSIENT BEHAVIOUR OF THE BLAST FURNACE AFTER CHANGE OF OPERATING VARIABLES AT THE TUYERE LEVEL. BISI 13486 SCHUSSMANN PETER //DIE INZSTRIE// 14/03/1975 V---- N---- PP 0016-00V AUSTRIAN F6REIGN'TRADE' ANALYZED 12 PP JPRS 64555 SCHUSSMANN PETER .//DIE INZSTRIE// 06/06/1975 V ---- IN ---- I PP 0015-0019 AUSTRIAN F6REIGN TRADE REVIEWED 10 PP JPRS 65445 SCHUSTER, 6. //VIRUS AND VIRUSKRAN?(HEITENI/ 00/00/1972 V---- N---- PP 0131-0137 VIRUS AND VIRUS 'DiSEASIE *NTIS TT 77-53325 SCHUSTERI H. J. //PTB-?tITTEILUNGEN// 00/00/1973/V---- N0006 PP 0389-0394 A PRINCIPLE FOR '~E OP~IMIZATON OF FILTERS FOR NUCLEAR SPECTROSCOPY WITH SEMICONDUCTOR DETECTORS AT HIGH PULSE RATES GO/DEFDRIC/TRAN-4OZ2-75 N SCHUSTER,, HANS //ARBEITSGEMEINSCHAFT VERSTAERKTE KUNSTOFFE MI TTEI LUNG SBLATT 00/00/1973,,V---- N0004 EUROPEAN RESEARCA AND 'TECHNOLOGICAL POLICIES FSTC-HT-23-685-75 SCHUSTER, HANS GUNTER //ARBEITSGEMEINSCHAFT VERSTARKTE KUMSTOFFE (AVK) MI TTEI LUNG SBLATT// V 00/00/19731 EUROPEAN RESE--AR-~AMMAND ~ECHNOLOG'Y POLICIES LECTURE BEFORE THE ELEVENTH ANNUAL MEETING OF THE STUDY GROUP FOR REINFORCED SYNTHETICS 33 PP GUO COPYRIGHT INFO. REFER OTHERS TO FSTC ARM/FSTC-AST-180OI-009-75 SCHUSZTER, EDE //RECHENTECHNIK, DATENVERARBEI TUNG// 60/07/1975100121N0007, PP 0070-0072 RESULTS AND TENDENCIES IN THE DEVELOPMENT OF THE USE Of COMPUTER TECHNOLOGY IN THE CONSTRUCTION INDUSTRY OF THE HUNGARIAN PEOPLE'S REPUBLIC 14 PP AIR/FTD/ID(RS)I-Cf6?1-76 SCHUTTEI H. //WASSERWIRISCHAFI// 00100119721VO022fN ---- f PP 0365-0367 POSSIBILITY OF USIK H DROCYCLONES FOR THE PURIFICATION OF FLUME AND WASH WATERS FROM SUr,AR FACTORIES *EPA BTR 583-75 000000046083 000000006988 000000017151 000000073914 000000044326 000000014035 000000067279 000000053885 000000016735 SCHUTTEj, W. 000000054673 //BEDRIJFSONTWIKKELING., EDITIE TUINBOUW// 00/00/19741V0005 N0007 PP 0671-0675 WORK STUDY ON A WRSER~, WHERE ORNAMENTAL TREE CROPS ARE RAISED IN POTS NRC C-16436 SCHUTZ 000000013661 //GESAMTZELLEN-ERMUEDUNGSVER SUCH F 104 G, ABSCHLUSSBERICHT, BERICHT// PP 0001-0106 NO TF 81120 TOTAL AIRFRAME FATIGUE TEST F 104 G FINAL REPORT 102 PP AIR /F TD-HC-23-08 42-7 5 SCHUTZ, A. 000000054362 //GIE SEREI// 00/00/1975 V0062PNO025, PP 0653-0658 4 FOUNDRY M ERIALS DANGEROUS TO HEALTH *BISI 14182 SCHUTZ, A. 000000042999 //GIESSEREI// 00/00/1975 V0062fN0025 PP 0653-0658 1 FOUNDRY P14FRIALS DANGEROUS TO HEALTH *eISI 14182 SCHUTZ ANDREAS GOTTHELF 000000030037 //BEKHREIBUNG F-INIGER NORDAMERIKANISCHEN FOSSILIEN// N---- 00/00/17911V --- ~ DESCRIPTION OF OME NORTH AMERICAN FOSSILS 16 PP USGS SCHUTZ R A. W ; 000000047080 //CO TE RENDUS ACADEMIE DES SCIENCES PARIS// ,N---- 00/00/1973fVO276 , PP 0939-0942 , , NEW ASPECTS OF TEXTILE FIBER STR ESS , NTC 75 11812-070 9 SCHUTZI R. A. 000000047082 //COMPTES RENDUS ACADEMIE DES SCIENCES. PARIS// 00100/1973,VO276,N----, PP 0999-1001 SERIES C THE MODIFICATION OF ACRYLIC STRUCTURES BY MECHANICAL FATIGUE NTC 75-11814-07D SCHUTZff R. 000000019915 //DEUTSCHE FORSCHUNGS-UND VERSUCHSANSTALT FUR LUFT-UND RAUMFAHRT INSTITUT FUR FLUGZEUGBAU// 00/00/OM V---- N~ STATIC-LOWD TEST~ N-~ LUF 205 WING OF SPARWISE TUBULAR CONSTRUCTION ESRO TT-162 SCHUTZE, RAINER 000000041798 //DEUTSCHE FORSCHUNGS-UND VERSUCHSANSTALT FUR LUFT-UND RAUMFAHRT INSTITUT FUR FLUGZEUGOAU// 00/09/1976 V---- N ---- po DLR-F8 76 16; If THEORETICAL AND EXPERIMENTAL INVESTIGATIONS ON LANDING GEAR SPRING BLADES OUT OF FIBER REINFORCED PLASTIC FOR SMALL AIRCRAFT ESA TT-312 SCHUllf WALTER 000000065263 //MONDi DIPLOMATIQUE,, LE// 00/10/1976,V----,,N----,f PP 0012-0013 FRANCO-GERMAN DEFENSE DISAGREEMENTS DISCUSSED 5 PP JpRS 68Z34 SCHUTZSACK AXEL if/WELT DfE// 06/08/1676,V--- N----, PP 0003 CHIEF JUSTICE C;LLS FOR IMPROVED ADJUDICATION, WEST GERMAN COMMENTARY 1 PP JPRS 67865 SCHVACA8AJAj I. K. //ARZNEIMITTEL-FORSCHUNG// 00/00/1970,VO020,N---- PP 0449-0451 RESULTS OF THE CLINICAt TEST OF CARBO- CHROMES FOR CHRONICAL CORONARY INSUFFICIENCY NTC 76-10012-060 SCHVARC F. METAINARNI MEDICINA// 00/00/19751VO020,NO003, PP 0129-0134 DYNAMICS OF CHANGES IN UTERINE GLANDS IN EWES WITH CHLOR SUPER LUTI NE SYNCHRONIZED ESTRUS *NTIS TT 77-53286 SCHVARTZMANI SALOMAD //MANCHETE// 19/0311977,V----,N----,, PP 0024-0025 SAO PAULO ARENA LEADER VIEWS BRAZILIAN POLITICS, NUCLEAR SITUATION 6 PP JPRS 69030 S CH W AS,, G. M. //MEMORIES SOCIETE ROYAL DES SCIENCES DE LIEGE// 00/00/1971,VO0011NO002 PP 0053-0063 THE OXIDATION OF METHAOL VAPOR ON AN*Ar3-ZNO AlIXED-CATALYST ERD/UUtL-TRANS-10835-75 9 SCHWABE, K. //BERICHTE DER BUNSENGESELLSCHAFT FUER PHYSIKALISCHE CHEMIE// 00/00/19641VO95NO001 PP 0046-0052 CELL PT,H20 lHBR AG28RX(S)/HG IN ORGANIC SOLU71ONS AND THEIR WXTURES WITH WATER. PTH2(l ATM)/H8R(M),, ETHANOL Mi, H20(100-X), HG2eR2/HG AEC-ORNL-TR--2955. SCHWABE, K. //BERICHTE DER SUNSENGESELLSCHAFT FUER PHYSIKALISCHE CHEMIE// 00/00/1969 V----,NO002, PP 0178-0184 CELL PT, H~ AEC/ORNL/TR-2956 SCHWABE, K. //JOURNAL FUER PRAKTISCHE CHEMIE// 00/00/197410316,0003, PP 0429-0433 ENZYMATICALLY CLEAVABLE SPECIFIC TRANSPORT FORMS OF CARCINOSTATIC AGENTS PART 1. NTC 75-10760-060 SCHWAHN' W. //GERLANDS OEITRME ZUR OEOPHYSIK/il 00/00/1975,V ---- IN0002 PP 0143-0154 A GENERAL FORMULATION 6F AUTO- AND CROSS- CORRELATION FUNCTIONS OF AN ARBITRARY STATIS- TICAL POTENTIAL FIELD IN A CARTESIAN COORDINATE 000000055368 000000065956 000000069125 000000064406 000000009335 000000039069 000000042349 000000019890 000000021298 SYSTEM *DMAAC SCHWAHNF We //GERLANDS BEITRAGE ZUR GEOPHYSIKI/ 00/00/1975,VO084 N0002, PP 0143-0154 A GENERAL FORMULVION OF AUTO-AND CROSS -CORRELATION FUNCTIONS OF AN ARBITRARY STATISTICAL POTENTIAL FILED IN A CARTESIAN COORDINATE SYSTEM OMAAC-TC-2128 S CH W Ali N, We /IGERLANDS BEITRAGE ZUR GEOPHYSIK// 00/00/1975pVO084..NO006 PP 0478-0486 TWO STATISTICAL DENSU~ MODELS AND THE FIRST- AND SECOND-ORDER STA71S71CAL MOMENTS OF THEIR GRAVITY FIELDS *DMAAC SCHWAfiNp We //GERLANDS BEITRAGE ZUR GEOPHYSIK// 00/00/1975 V0084,NO006 PP 0478-0486 TWO STATIi~ICAL DENSIii 140DELS AND THE FIRST- AND SECONO-ORDER STATISTICAL MOMENTS OF THEIR 6RAVITY FIELDS OMAAC-TC-2209 SEHWALBEjp He Jo //BATTELLE-INSTITUT E.V. FRANKFURT AM MAIN// 00/12/1975 V --- ;~N --- ? P~ 0046 STUDY OF iAE CR K RE ISTANCE OF FIBER-REINF- FORCED PLASTICS- USE OF NEW NONDESTRUCTIVE TESTS FOR EARLY DETEC~ION OF DAMAGE IN COMPOSITE MATERIALS SUBJECTED TO ALTERNATING LOADS AEC-UCRL-TRANS--10929 SCHWALBE, HANS-JOACHEM MATTELLE -I NSTI TUT E.V. FRANKFURT AM MAIN// 00/09/1975,V----,N ---- I AN 1216 - STUDY OF THE CRACK RESISTANCE OF FIBER- REINFORCED PLASTICS- AND AM 12/10 - USE OF NEW NONDESTRUCTIVE: TESiS FOR EARY DETECTION OF DAMAGE IN COMPOSITE MATERIALS SUBJECTED TO ALTERNATING LOADS, PERIOD COVERED: I MAY 1973 THROUGH 30 APRIL 1974 ERDA UCRL TR-10929-75 SCHWm'p He //ZEITSCHRIfER FUER NATURfORSCHUNG SERIES B// 00/00/1948 V --- ?NO00310PP 0361-0367 ._.TEMPERATURE DEP NDENCE F THE DIELECTRIC CONSTANTS OF BLOOD AT LOW FREQUENCIES CSO 8344/1,567C COMPLETE SPECIALS sc"wmt Re //MASNIMENMARKT/I 00/00/1972 V0078 N---- PP 0652-0656 NEEDLE FELi PREHPITAT~S DUST NTC 75-11529-13K SCHWANDT.* S. //bRAHT-WELT// 00/00/19701VO056fNOOlO,, PP 0574-0581 THE DEFORMATION BEHAVIOUR OF PLAIN-CARBON AND LOW-ALLOY STEELS 00 ING BULK DEFORMATION 000000032901 000000048455 000000059568 000000042368 000000023045 000000005348 000000028171 000000069508 *BISI 15496 SCHWANDT, S. 000000072820 ttDRAHT-WELT// 00/00/1970oV0056,00101 PP 0574-0581 A DEFORMATION BEHAVIOUR OF PLAIN-CARBON AND LOW ALLOY STEELS DURING BULK DEFORMATION 8111 15496 SCHWANITZ GUENTHER 000000021235 /MORIZOW/ 17106/1974,,VO007,,ND026 PP 0014-0015 GDR REPORT ON CSSR TRZE UNION CHIEF KAREL HOFFMANN JPRS 62970 N SCHWANITZ,, GUENTHER 000000002974 //MORIZONT/I 17/06/19741VOOO?,.NO029f PP 0014-0015 -AEPORT ON CSSR TRADE UNION CHIEF KAREL HOFFMANN 5 PP JPR5 62970 SCHWANNf J. 000000073028 / /MEDY Cl NA WETERYNARYJNA// 00/00/1964 V0020 N0004 PP 0218-0221 A CASE OF INFECTION WI~H A STYLE VIRUS OF APHTAE EPIZOOTICAE *NTIS TT 77 54072 SCHWARTZ, GUNTER K. 000000058202 /IKETALL// 00/00/197410028,0006, PP 0586-0590 COMMUNICATION OF THE LANGBEIN PLANHAUSER WERKE AG, DIVISION OF APPLIED CHEMISTRY 12 PP ERDA/ORNL-TR-4.135-76 ScHoull U. 000000043885 //TECH. -TECHNI SCHE UNIVERSITAET BRAUNSCHWEIG// 0010011975f V---- N0117 LOADING OF PLUG N C06ER CONTACTS WITH HIGH DIRECT CURRENTS ORML TR 4001 SCHWARTZ, W. 000G00067585 //ZEITSCHRIFT FUER ERZBERGBAU UND METALL- HUETTENWESEN// 00/00/1972,,V0025 N---- PP 0505-0511 EXAMPLES AND LIWITS OF'AIR PURIFICATION IN THE'COPPER SMELTING PLANTS #TC 76-10059-11F SCHWARTZ'. W. 000000067586 _//Z(ITSCHRIFT FUER ERZBERGBAU UND METALL- HUETTENWESEN// 00/00/1973 V0026 N---- PP 0113-0120 MODERN SMEtTING ~ROCEAES FOR FINELY DIVIDED COPPER-CONCENTRATES N.TC 76-10061-11F SCHWARZ. K. P. 000000018909 /-/DEUTSCHE GEODATISCHE KOMMISSION SERIES C DISSERTATIONS// 00/00/1975 V---- N0209 PP 0001-0058 ZONAL SPHikl CAL hARMONf C COEFFICIENTS FROM SATELLITE DATA BY COLLOCATION DMAAC TC 2130 SCHWARZ, K. P. 000000019418 //DEUTSCHE GEODATISCHE KOMMISSION SERIES C DISSERTATIONS// 00/00/1975 V----,N0209 PP 0001-0058 4 i ZONAL SP 1CAL HARMON c COEFFICIENTS FROM SATELLITE DATA BY COLLOCATION DMAAC TC 2130 SCHWARZ, 8 000000026040 //BERICHTE AUS DER BAUFORSCHUNG// OWDO/1973 V---- N0086, ENTIRE I SS6E DRIVING RAIN. METHODS OF MEASUREMENT-STRESSES PRODUCED-EFFECTS NTC 74-13409-13M SCHWARZ,. D. 000000045379 //ENERGIE UND TECHNIK// - 00/00119731V0025 N0004 PP 0092-0096 ALSO NO 5 PP 125~128 AD NO 7 PP 191-194 1973 DEVELOPMENT OF HIGH TEMPERATURE REACTORS IN THE GERMAN FEDERAL REPUBLIC. PART 11 11 AND Ill. NTC 75-12990-181 SCHWARZ F. J // li Fi 000000041884 ZE SCHRI FUER TIERPHYSIOLOGIE TIERERNAEHR UNG UND FUTTERMITTELKUNDE// 00/00/1973f V0031 N---- PP 0091-0099 f INTESTINAL CU AWSORPTI ON IN VITRO AFTER ___FE OR ZN DEPLETION NTC 75-11082-06P SCHWARZf 6o K. 000000074801 /IZEITSCHRIFT FUER INDUSTRIYA FERTIGURG// 00100/1977fV---- N0067 PP 0111-0117 t ~ CLEAKIK Of META SURF CES WITH AQUEOUS SOLUTIONS, WITH THE MAIN STRESS BEING LAID ON ELECTROPLATING *BISI 15643 SCHWARZ HAN$-PETER ;f 000000075676 A-ARC9IV// t/EUR 1010611977 V---- N---- PP 0327-0338 p NEED FOR A NEW GERMANY POLICY CONCEPT DISCUSSED 12 PP GUO PAS L/7255 SCHWARZ, r'. P. 000000033895 44DEU7S(AE GEODATISCHE KOMMISSION// 00/00/1975 V----,NO2M PP 0001-C08 ii I Z014AL SPH ICAL HARMON C COEFFICIENTS FROM SATELLITE DATA BY COLLOCATION *DMAAC SCHWARZ, r. P. 000000056108 //ZEITSCHRIFT FUER VERMESSUNGSWESEN// 00/00/1976 V0101 N0006 PP 0221-0230 NUMERICAL PROBLEAS IN in DETERMINATION OF THE GLOBAL EARTH GRAVITY FIELD BY COLLOCAlION _*DMAAC SCHWARZBACH/ R. 000000030509 //$TAAILICHE ZENTRALE FUER STRAHLENSCHUTZ SZS-14~// 00/00/1972, V---- N----iHPP 0020-0028 LABORATORY STUDIH ON E ADSORPTION OF RADIO- -IODINE COMPOUNDS ON ACTIVATED CARBON AIR /FID-1 D(RS) 1-1577-75 SCHWARZE,, Go //ZEITSCHRIFT FUR MESSEN STEUERN// 00/00/1964..Vooo? N00011 PP 0010-0018 ALGORITHMIC DETEkMINATION OF THE ORDER AND TIME CONSTANTS FOR P-,I- AND 0 MEMBERS WITH 2 DIFFERNT TIME CONTANTS AND DELAY UP TO 6TH ORDER C.E. TR 6966 -SM AR Z E, G. /IZEITSCHRIFT FUR MESSEN STEUERN// 00/00/1965 V0005 AN00101 PP 0356-0359 SURVEY OF i~E TI E PERCENTAGE CHARACTERISTIC METHOD OF DETERMINING THE TRANSFER FUNCTION WEIGHT FUNCTION, TRANSIENT RESPONSE AND SLOPE RESPONSE C. E. TR 6968 SCHNARZENBACH, G .--//HELVETICA CHIkCA ACTA// 00/00/19611VO036 N---- PP 0023-0036 I If METAL COMPLEXES WITH POLYAMINES. PART IX THE INTERPRETATION FO THE STABILITY CON STANTS OF THE SILVER COMPLEXES NTC 74-12478-07C SCHWARZENBERGf L. //PRESSE MEDICALE// 00/00/1969 V0077 N---- PP 0385-0388 A NEW COM6ATIA OF M'ETHOTREXATE AND FOLINIC ACID IN CANCER TREATMENT ACUTE LEUKEMIAS AND SOLID TUMORS NTC 74 13939-060 SCHWARZMAMN, M. //CHEM.-CHEPtIE INGENIEUR TECHNIK// 00/00/19?5,,V----..N0002,, PP 0056-0061 METHANOL A.RAW MATERIAL FOR SYNTHESIS AND AN ENERGY SOURCE UCRL TRANS 10908 SCHWARZMANNI MATTHIAS //CHEM.-CHEMIE INGENIEUR TECHNIK// 00/00/1975,,V0047,0002, PP 0056-0061 METHA14OL: A RAW MATERIAL FOR SYNTHESIS AND AN ENERGY SOURCE ERD/UCLR/TRANS-109OB-75 SCHWAVEf K. //INSTITUT FOR ELEKTROCHEMIE UND PHYSIKALISCHE CHEMIE DER TECHNISCHEN UNIVERSITAT DRESDEN// 00/00/1963,V---- THE CELL IN ORGAiC SOLUTIONS AND THEIR MIXTURES WITH WATER -----ERDA/ORNL/TR-2955-75 SCHWAVE,, K. //INSTITUT FUR ELEKTROCHEMIE UND PHYSIKALISCHE CHEMIE DER TECHNISCHEN UNIVERSITAT DRESDEN// 00/00/1963 V---- m THE CELL I~ ORGAiC SO'LUTIONS AND THEIR MIXTURES WITH WATER ERDAIORNL/TR-2955-75 SCHWAVE/ K. //INSTITUI FUR ELEKTROCHEMIE UND PHYSIKALISCHE CHEMIE DER TECHNISCHEN UNIVERSITAT DRESDEN// 00/00/1963fV---- N ---- THE CELL IN ORGAiC SO'LUTION$ AND THEIR MIXTURES WITH WATER 000000058992 000000058994 000000009802 000000027807 000000043876 000000019980 000000019107 000000019616 000000036734 ER D A /OR NL/TR -2955-75 SCHWEDLE Ro H. //MONATSHEFTE FUER VETERINAERMEDIZIN// 15/02/1975,t V ---- I IN, ---- I PP 0122-0132 RESULTS, GOALS OF VETERINARY MEDICINE OUTLINED 17 PP JPRS 65032 SCHWEGMANN, B. /IFARBE UND LACK// 00/00/19741V0080IN ---- f PP 0311-0316 DISPERSION IN THE DISSOLVER NTC 74-13924-11C SCHWEGMANNf B. //FARBE UND LACK// 00/00/1974,,V0080 N0010 PP 0942-0945 THE VALUE OF CURk[NT FfNENESS MEASUREMENTS NTC 75 118197-11C SCHWEGMANNt 0. //FARBE UND LACK// OO/0O/1974fV0080 N0010 PP 0942-0945 THE VALUE OF EURkENT FfNENESS MEASUREMENTS NTC 75 11819-11C. SCHWEI6ER G. //DEUTSiAE FORSCHUNGS- UND VERSUCHSANSTALT FUER LUFT- UND RAVMFAHRT. REPORT DLR-MITT 73-02// 00/00/1973,.V---- N ---- THE USE OF EQUIDSSITAETRY FOR THE DIAGNOSIS OF TWO-PHASE FLOW AND LOW-DENSITY FLOW NTC 74-13590-20D ON LOAN SCHWEIGER GERWIN //DEUTS6E AUSSENPOLITIK// 00/08/197500020fN0008,, PP 1220-1228 6DR ANALYSIS OF CHANGES IN U.S. CONGRESS-WHITE HOUSE RELATIONSHIP 9 PP JPRS 65868 SCHWEISFURTH R //GWF-WASSEA IWSWASSFR 00/00/19720V0113IN ---- 0 PP 0162-0172 NO ENGLISH TITLE *NTIS TT 77-59070 SCHWEISFURIN R //ZEITSCHOT iUER ALLGEMEINE MIKROBIOLOGIE// 00/00/1973 V001310004~ PP 0341-0347 .00 RENGLI ~ TITL *NTIS TT 77-59069 SCHWEITZEN R. //RAPPORiNATIONAL: FRANCE// 00100/0000,V ---- tN ---- I ENGLISH TITLE UNKNOWN JPRS FOR INTERIOR DEPARTMENT BUREAU OF MINES SCHWEIZER,, G. //PAPIER DARMSTADT// 00/00/19?5f V0029 N---- PP 0009-0015 STUDY Of THE CHAACTER'ISAT10N OF PAPER FIBRE MATERIAL BY ITS SPECIFIC SURFACE PIRA-1257 000000010005 000000023854 000000043022 000000054385 000000026220 000000028995 000000071155 000000071156 000000065094 000000062123 SCHWENKO W. 000000023315 //ROHRE ROHRLEITUNGSBAU ROHRLEITUNG STRANSPORT// 00/00/1973 V0012,NO001, PP 0015-0020 THE SIGNIFfCANCE OF THE ADHESIVE STRENGTH OF THICK COATINGS FOR THE PROTECTION OF STEEL PIPLINES AGAINST CORROSION WI 13079 SCHWENK,, W. 000000012221 //ROMRE ROHR LEI TUNG SBAU ROHRLE17UNGSTRAN SPORT// 00/00/19731VO012 N0001 PP 0015-0020 SIGNIFICANCE OF iHE ADAESIVE STRENGTH OF THI'CK COATINGS FOR THE CORROSION PROTECTION OF PIPELINES OPINIONS EXPERIMENTS RESULTS * 81 SI 13079 SCHWENZFElER, L. 000000056154 //OHM// 00/00/1976.. V ---- ~N0003 0074-0093 HEAT BALANCE IN OT ROLING *BISI 14438 SCHWENZFEIER, W. 000000003127 //OHM// 0011111972gV--- N0117 PP 0445-0451 CONTACT-LESS SP~ED MEWSUREMENTS BISI 12166 SCHWERDTEL W. 000000041847 //CliEM.-a;EMIE-INGENIEUR-TECHNIK// 00/00/19681VO040 N---- PP 0781-0784 VINYL ACETATE WN ETOLENE BASE IN THE GASEOUS PHASE -'NTC 75-10972-07A SCHWERDTFEGER, K* 0000OM6727 //MANNESMAN FORSCHUNGSBER// 00100/1971 V --- ~N0570 PP 00 REOXIDATIO; OF LupaNI(m-rILLED STEEL BY CONTACT WITH REFRAC70RY MATERIALS *8151 14736 SCHWERDTFEGER, K. 000000065021 //ARCH.-ARCHIV FUER DAS EISENHUETTENWESEN// --00/00/1974,V0045 N---- PP 0649-0655 SOLUBILITY Of NNOGEN'IN CAD-AL203 MELTS .114 GRAPHITE CRUCIBLE AT 1600 DEGREES C NRC C-17661 SCHWERIN, OTTO 000000047876 11EVROPA MCHIV// --00/00/1975lV----,NO015j PP 0483-049? EC UNITY IN CSCE 11 FF 6UO CSO: 8120/0457-76 COMPLETED SPECIAL SCHWERTASSEK, r.. 000000027762 //TEXTIL-PRAXIS INTERNATIONAL// 00100/1974jV0029-00011 PP 0096-0100 EXPLANAIION OF RON-UNI ORMITIES IN THE DYEING Of TEXTURIZED POLYESTER YARNS NTC 74-13285-11E SCHWEIZ, F, 000000068891 //KONATSSCHRIFT FUER OHRENHEILKUNDE UND LMYNGO-RHINOLOGIE// 0O/O0/1969,V020.3,N----, PP 0105-0110 TONE AND SPEECH HEARING IN ACOUSTIC TRAUMA *FSTC IMIS 18101-085-77 SCHWETZ F. //MONiiSSCHIFT FUER OHRENHEILKUNDE UND LARYNGO-RHINOLOGIE// 00/0011979,0104 N---- PP 0162-0167 EXPERIMENTAL HiAING 16AIRMENT AND ITS READUUSTMENT UNDER CALM AND NOISE CONDITIONS *FSTC IRIS 18101-121-77 SCHWIEZER, G. /(WOCHENDLATT FUER PAPIERFABRIKATION/1 00/00/1973 V010lfN---%IPP 0921-0926 SHEET FORWNG ON TWIN RE FORMERS NTC 74-13734-11L SCHWINDT, H. J. //ELEC.-ELEKTROWAERME INTERNATIONAL// 00/00/1974fVO032 N---- NUMBER BZf pp B76-682 UTILI SATION OF WASTE HEAT FROM INDUCTIVE MELTING INSTALLATIONS NTC 75 11479-13A SCHWINDTP H. J. //ELEC.-ELEKTROWAERME INTERNATIONAL// 00/00/1974fVO032 NOOOO.* NO, B?l PP 878-W~ UTILISATION OF WASTE HEAT FROM INDUCTIVE MELTING INSTALLATIONS NTC 75 11479-13A SCHWINNf MDNIKA //DER SPIEGEL// 02/04/1973 V---- N----.? PP 0068-0069 ALSO PP 72~73f76'48 80 AND 83 DON'T BREAK YOUR TEiTH ON ME 19 PP CSO: 8020/2088 COMPLETED SPECIAL SCHWOEBEL JEAN //THE TNES// 07 /10/1975t V ---- If N ---- t PP 0001 SUPPLEMENT EUROPA ALSO P XI INTERVIEW WITH ALGERIA'S BOUTEFLIKA ON WORLD TRADE 5 PP GUO JPRS L/5490 S CH WUNG ER f K. J //CHEM.-CHEMIE-INGENICUR-TECHNIK// 00/00/1971,,VO043 N---- PP 1075-1078 AUTOMATIC APPARA%S FO'R THE MEASUREMENT Of THE SURFACE TENSION BY THE WILHELMY METHOD NTC 75-12470-148 SCHYPEK.0 io //NEUE ZUERICHER ZEITUNG// 09/06/19l6lV----,,N0131 PP 0032 PROTECTIVE WORK CLOTHIk FOR USE UNDER EXTREME CONDITIONS ARM/FSTC/AST 18401-206-76 SCIAMAf G. /IFONOERIE// 00/00/1975.,V ...... N03471 PP 0247-0263 00000OW898 000000023812 000000042884 000000054250 000000026270 000000046557 000000048979 000000074128 000000042445 CONTRIBUITON TO THE STUDY Of RISER NECKS FOR DIFFERENT ALLOYS *BISI 13880 SCIOLI, C. //61ORNALE DI MALATTIE INFETTIVE I PARAS4ITARIE// 00100/19741,VO026 N---- PP 0624-0630 WRATION OF AGGtUTIN4ING ANTIBODIES IN A NAPLES POPULATION SAMPLE SUBJECTED TO VACCINATION AGAINST CHOLERA NTC 75-13197-06m SCOLNIKO, J. //OOmOTO/l 0O/O0/1974lfV____,,NO398f PP 0092-0096 KINETHERAPY ES-1026 SCOTTI, LUIGI /I ANNALS. -ANNALI 01 eOTANICA// 00/00/19070, V0006? V---;, OPP 0025-0096 CONTRIBUTIONS TO THE LOGICAL FLORA NYRTIFLORAE *NTIS TT 76 53266 9 SCOWCROFT, w. R. //PLANT SCIENCE LETTER// 00/00/1976fV0007PN-~--, PP 0039-0042 ORGANOGENESIS FROM ALLUS CULTURES OF THE LE6UME CSIRO SCOWCROFT R. //PLANT ~CWI*ENCE LETTER// 00/00/1976p VOW N --- ~t PP 0039-0042 OR6ANOGENESIS FR6M CA US C ULTURES OF THE LEGUME CSIRO SCZIMAROWSKY, r, //METALL// 00/00/1975 V0029 N---- PP 0774-0777 MICROFRACigRAPHIC STUSY OF GAS-CONTAINING COPPER PRODUCTS NTC 76-1000-11F SDOBNIKOVI So //SEL' SKAY A ZHI ZN// 24/09/1974tV---- N---- PP 0002 AGRICULTURAL DEALOPMEAT IN NONCHERNOZEM ZONE 5PP JPRS 63287 SDOBNIKOV, S //ZEMLfiDELIiE// 00/11 /1976,f V ---- fNGOllf PP 0066-0068 STANDARDIZATION OF TERMINOLOGY FOR SOIL CULTIVATIO WoRK 7 PP Guo JPRS L/7125 SDOONIKOV,, V. 0. //KEFTEGAZOVAYA GEOLOGIYA I 6EOFIZIKA// 00/00/1976 V---- R0007 PP 0015-0019 DEVONIAN ZD CAR9NIFEkOUS DOWNWARPS IN THE NORTH AND NORTHWEST PARTS OF THE PERI-CASPIAN 000000053119 000000046135 000000047038 000000074811 0000-00075272 000000067577 000000000326 000000066791 000000065821 DEPRESSION AND THEIR PROSPECTS FOR OIL AND GAS VOL 14 NO 2 FEBRUARY 9177 PETROL~UM GE6LOGY SDOROVA, M. P. //VESTNIK LENINGRAD UNIVERSITET// 00100/1973,,V ---- $,N0010#9 PP 0121-0123 INVESTIGATION OF ELECTROKINETICS POTENTIAL BY THE METHOD USING THE STREAMING POTENTIAL ON A ROTATING DISC NTC 75 11439-070 SE? P. //SLEVARENS7VI 00/00/1976.. V --- ~NOOO4, PP 0131-0134 THE EFFECT OF C DON MANGANESE,, SILICON AND ALUMINUM CONTENT ON ~HE MORPHOLOGY OF SULPHIDIC INCLUSIONS IN HIGH-SULPHIDIC INCLUSIONS IN HIGH- SULPHUR INCLUSIONS IN HIGH-SULPHUR 0.2 TO 0. BASIC STEEL *eISI 15037 SEAKI,, Y. //KOGYO KAGAKU ZASSHI// 00100/19711VOU74 N---- PP 0344-0348 CHLORINATION Of I~ROMAM OXIDE NTC 75 12354-078 SEBEKIN I. S. /IKAUiAUK I REZINA// 00/01/1975fV---- NO001 PP 0001-0003 TREATMENT OF RUAER INSUSTRY EFFLUENTS 5 PP JPRS 64488 SEBESTYEN, ARai GH. //REVUE..-REVISTA ECONOMICA// 30/01/1976,V---- 'N0004 PP 0002-0004 SYSTEMATIZATION AND 14ECTS ON FUTURE DEVELOPMENT' CONSIDERED 7 PP JPRS 67138 SEBOR VACLAV //TRiBUNA// 02/03/1977lV____,,N00O9j Pp 0010-0011 PROGRESS WITH CSR GYPSIES CLAIMED 5 PP JPR5 69033 SECHANOVf IV. 11KHIGI.ENA I ZDR AVEOPAZ VANE// 00/00/1974f V ---- fNO0021 PP 0101-0109 DEVELOPMENT Of HEALTH SERVICES OUTLINED 11 PP JPRS 6Z734 SECKOLDf J. A. //APPLIED OPTICS// 00/00/1976,V0015 N0007f PP 1693 OPTICAL POLISHIN~ WITH TITANIUM DIOXIDE CSIRO 351 SECONSKI, KAZIMIERZ //POLITYYA// 04/01/19l4fV----,NOCloll Pp 0001 ALSO P 14 DYNAMIC ECONOMIC, DEVELOPMENT ANALYZED 12 PP JPRS 63985 000000037735 000000063089 000000037870 000000011116 000000032347 000000064733 000000000853 000000069672 000000004393 SECOMSKI, KAZIMIERZ //NOWE DROGI// - O0/06/1974,V----,N0006, PP 0076-0086 COURSES OF SOCIOECONOMIC DEVELOPMENT ANALYZED 12 P JPRS 62668 SECOMSKI, KAZIMIERZ //60SPODARKA PLANOWA// 00/07/1974 V----,,NOGG? PP 0429-0435 ECONOMIC DiVELOPMENT AD STRUCTURAL CHANGES ANALYZED 14 PP iPRS 62910 SECOMSKI, KAZIMIERZ //ZYCIE 60SPODARCZE// 21/07/1974,V---- 'N0029 PP 0008-0009 LONG-RANGE SOCIOECONOidC DEVELOPMENT PLAN OUTLINED JPRS 62724 SECOMSKI, KAZIMIERZ //NAUKA POLSKA// 00/11/1974PV ---- ING0061 PP 0040-0050 ALSO NOV-DEC 74 SOCIOECONOM C DEVELOPMENT POLICY ANALYZED 12 PP JPRS 64158 SECOMS KI, KAZIMIERZ. //GOSPODARKA PLANOWA// 00/04/1976rV----,NG004 PP 0181-0187 SECOMSKI COMMENTS ON dNTRAL MACROREGION PLANNING 7 PP JPRS 67594 SECULI BRILLASf 0. JOSE //NOTICIAS NEOSAN// -00/00/1960,,V0102 N ---- IPP 0365-0380 NO ENGLISH TITLE *XTIS TT 75 53218 SEDACH,, G. A. //IZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/00/1975 V---- N0003,. PP 0058-0061 THERMODYNAiC FEVURES OF THE DEPHOSPHORIZATION OF CHROMIUM METAL IN THE OPENNEARTH FURNACE 81W.13442 SEDACH G. A. IIIZVESTIYA VUZ CHERNAYA NETALLURGIYA// 00100/1975 V ---- IN0003, PP 0058-M1 THERMODYNAIC FEATURES OF THE DEPOSPHORIZATION OF CHROMIUM METAL IN THE OPEN HEARTH FURNACE *BISI 13442 SEDAGHATf 0. //COMPTES RENDUS ACADEMIE DES SCIENCES// 0010011971.f V0273 N---- PP 0229-0232 EVALUATION OF TO~AL AL~EOLM MACROPHAriE POPULATION IN RATS WTC 76-10043-06C SEVAGHAT S. //COMPiES RENDUS HEBDOMADAIRES DES SEANCES DE L'ACAOEMIE SCIENCES/ SERIES D// 12/07/197lfVO273 N---- PP 0229-0232 EVALUATION OF TO~AL AL~EOLAR MACROPHAGE POPULATION 000000000759 000000002996 000000000815 000000004676 000000051960 000000025650 000000026390 000000031518 0000M5555 000000039695 IN RATS 11 PP ERDA LF TR-102 SEDAK 1. N. /tS40ITEL'STVO I ARKHITEKTLPRA// __OO/OO/ 19 76dr V ---- INOO12, PP 0003-0007 ARCHITECTURE AND CONSTRUCTION IN THE UKRAINE 14 PP GUO JPRS L/5716 000000037140 SEDAKOV,p L. P. 000000049526 USUDOSTROYENIYE// 00/00/1975PV---PN0011, PP 0015-0019 TECHNICAL DIAGNOSTICS AS A MEANS OF IMPROVING ----THE RELIABILITY OF MARINE POWER EQUIPMENT SEDAT G. 000000059256 41R WPOR T D 'ETUDES SUR LA FAISABILITE DES COMPOSITIONS PYROTECHNIQUES COULABLES A FUME COLOREE FLAMME ET FUMEE COLOREES// 23/07/1975 V---- N---- NUMBER 40h5 STUDY REPORT ON THE FEASIBILITY OF CASTABLE PYROTECHNIC COMPOSITIONS WITH COLORED SMOKE AND/OR COLORED FLAME AND SMOKE CHARGES FSTC-1867-75 FSTC-AST-11601-024-75 .-SEDAT GEORGES 000000048309 11RWPORT D'ETUDES SUR LA FAISABILITE DES COMPOSITIONS PYROTECHNIQUES COULABLES A: FUMEE COLOREE, FLAMME ET FUMEE COLORESS// 00/00/1975 V---- N0040 STUDY REP9T ON 'i~E F6SABILITY OF CASTABLE PYROTECHNIC COWOSITIONS WITH COLORED SMOKE AND/OR COLORED FLAME AND SMOKE CHARGES *FSTC AST-11601-024-75 SEDEGOV, R. //ECON.-EKONOMICHESKAYA GAZETAI/ 00/01/1977 V--- N0005 PP 0010 ALSO COLUA 1 AUTOMATIC CONTROL SYSTEM AT THE INSTITUTE 2 PP GUO COPYRIGHT INFO REFER OTHERS TO FTD/STINFO FTD-ID(RS)1-0804-77 SEDENKO; M. V. //PODZEMMAYA GAZIFfKAT.SIA UGLEI// 00/00/1957,v ---- PONOO03 PP 0047-0052 DEWATERING A GASIFICAffON ZONE IN THE DNIEPER REGION FOR UNDERGROUND COAL GASIFICATION ER DA SEDENKO, M. V. //PODZEMMAYA GAZIFIKATSIYA UGLEI// 0O/OO/195?,,V----,NOO03, PP 0047-0052 DRYIK OF THE AREA OF THE PRIDNEPROVSK UNDER GROUND-GASIfl CATION STATION ERDA/UCRL-TR-11067-76 SEV4LEY,, K. //NEW PHISTTOLOGY// __0/0O/1976,,VO077,,N ---- t PP 0149-0152 CONTROL BY THE EMBRYOSAC OVER POLLEN TUBE GROWTH IN THE STYLE OF THE AVOCADO CSIRO SEDGLEY10 M, IINEW PHYTOLOGIST, THE// 0000OM9860 000000044013 000000059186 000000075286 000000074827 00/00/1976,VOO?7 N ---- f PP 0149-0152 CONTROL BY THE E~BRYOSAC OVER POLLEN TUBE GROWTH IN THE STYLE OF THE AVOCADO CSIRO SEDINA, YE. M //TEKSTILNAY~ PROMYSHLENNOST// 00/00/1968 V0028 N0001 Pp 0 0042-0043 AIR PERMEAILITY'OF GLOED NONWOVEN FILTER WERIALS NNTC 75 11833-11E SEDINAf YE. M. //TEKSTILNAYA PROMYSHLENNOST/I 00/00/1968 V0028 NO001 PP 0042-0043 AIR PERMEAiLITY'OF G6ED NONWOVEN FILTER MATERIALS NTC 75 11833-11E SEDIVY,, ILJA //ZIVOT STRANY// 00/07 /19740, V --- ~60015.. Pp 0007-0008 'ZIVOT STRANY MMENTS ON BREZHNEV-NIXON TALKS 5 JPRS 62731 SEDLACEK, B. A. J. //NAHRUNG, DIE// -0229 00/00/1975 V0019 N0003 PP 0219 THE EFFECi'OF AS'CORSYL'PALMITATE AND OTHER ANTIOXIDANTS ON THE AUTOMATION OF FATS *FS7C IMIS 18001-007-77 SEDLACEK K. //CESKOSLOVENSKA OTOLARYNGOLOGIE// 00/00/19721voozi Noool PP 0004-0007 CONCEPTS OF THE iERMS SUSCEPTIBILITY AND RESISTANC AS THEY RELATE TO HEARING DAMAGE DUE TO NOISE AlFt/FTD-HC-23-2783-74 SEDLAK W. //KOAOS BIOLOGIYA SERIYA A// 00/00/19751VO024fN ---- f PP 0261-0272 RR. 3034) THE DYNAMICS'OF BIOPLASMA AND MATABOLISM 18 PP AIR /FTD-ID(RS) 1-0520-77 SEDLETSKIY, Vo 1. //DOKLADY AN SSSR,, EARTH SCIENCES// 00/00/19751VO220 N0005 PP 1153-1154 UPPER JURASSIC EOAPORi'IES OF CISAUCASIA Aril SE0ORCHENKO V F //PRAVOVEDiNIi//' 00/00/1972,v----,Noooll PP 0050-0053 EFFECT OF SPECIAL ASSIGNMENT OF RECUE SHIPS ON AMOUNT OF REWARD CSO: 8144/2185 COMPLETED SPECIAL SEDOV, K. R. //soVETSr,0Yf ZHAVOOKHRAMENIYE// 0010011975,V---- NOOO? PP 0021-0025 ORGANIZATION OF SMIT4Y-MEDICAL SERVICE FOR WORKERS OF THE WEST REGION OF BAN IN THE WORK OEVELOPMENT PERIOD 6 PP JPRS 65579 000000054391 000000043028 000000000839 000000068865 000000003627 000000071033 000000053212 000000009150 000000026780 SEDOV,, L. 1. //OOKLADY AKADEMII NAUK SSSR// OO/OO119?6fVO231,.NOOO6j PP 1311-1314 ON THE EQUATIONS OF' INERTIAL NAVIGATION TAKING ACCOUNT OF RELATIVISTIC EFFECTS *DMAAC SEDOVA.. 1. S. //DOKLADY AN SSSR.. EARTH SCIENCES// 00/00/1975fVO220?NDO04 PP 0949-0952 GEOCHENICAL TREND OF GkANITIZATION PROCESSES IN THE VITIM-OLEKMA HIGHLANDS AT DIFFERENT ALKALI CONCENTRATIONS AGI SEDUNOVf YU. S. //METEOROLOGIYA I GIDROLOGIYAI/ 00/00/19750, V---- N0009 PP 0107-0111 AMERICAN RESEAR6 ON ThE WEATHER MODIFICATION PROBLEM 10 PP JPRS 66453 SEDUSH, V. YA. //IZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/00/1976,V----,NOOOZ PP 0007-0091 DEFORMABILITY OF TH HO~ METAL AND THE MAKING FORCE DURING MAKING. *81SI 14364 SEDYKH, ANDREI //NOVOYE RUSSKOYE SLOVO// 15/03/1977,V----,N----, PP 0003 NEW YORK CSO 8044/0921-77 COMPLETED SPECIAL SEDYKH, V. //KOMMUNIST/I -- N0018 PP 0066-0073 00112/1974 V-- A MEETING .6F MAJOR SIGAIFICANCE, ON THE RESULTS OF THE SOVIET-FRENCH SUMMIT TALKS 10 PP JPRS 63910 SEDYXHf V. //KOWUNI ST// 00/09/1976 V---- N0014 PP 0079-0089 JACQUES 6YCLOS-4PATRIO~ AND INTERNATIONALIST 14 PP 6U0 JPRS L/6637 SEDYKH, V. //KOMMUNI ST// 00/04/1977f V ---- fN00D6 PP 0079-0090 HISTROICAL ENCOUNTER 1~ PP JPRS 69154 SEDYSHEVf YU. IIECON.-EKONOM CHESKIYE NAUKI// 00/04/1977fV___;jNCl004,, PP 0056-0065 USE Of VALUE IN CATOR 5 TO ASSESS PRODUCTION EFFICIENCY EXPLAINED 12 PP Guo JPR9 L/7232 SEE8ERf F. //STAU8-REINHALTUN6 DER LUFI// 0O/04/1971,,VO031,,NOOO4,, PP 0161-0163 000000070674 000000053250 000000027165 000000053378 000000065053 000000002476 000000067044 000000069299 000000073795 000000050288 FIRES AND EXPLOSIONS IN SILO INSTALLATIONS OF THE WOOD INDUSTRY 10 PP ERDA/ORNL-TR-4102 SEEFELD, K. F. /JVGB ONEDAY MEETING ON BOILERS AND BOILER OPERATION// 25 /05./19741 V---- N---- PP 0000 DES16N LIMIT PROKEMS 'OF LARGE FOSSIL-FIRED STEAM G ENER ATOR S C. E.'TRANS 6568 SEEGER P P. 6. //VEREINIGUNG ZUR FOERDERUNG DES DUETSCHEN BRAND-SCHUTZES ZEITSCHRIFT// 00/00119721V0021 N0004, PP 0125-0132 FIRE AND VENTILAION TESTS IN HIGH RISE DWELLING WITH INTERNAL STAIRCASE NTC 74-13986-13L SEELIG,. H. P. . //ZEITSCHRIFT FUER KLINISCHE CHEMIE UND KLINISCHE BIOCHEMIE// 00/00/19690OV0007 N---- PP 0581-0585 THE JAFFE REACT16N WITA CREATININE. REACTION PRODUCT AND GENERAL REACTION CONDITIONS NTC 74-11846-06A SEFER, BERISLAV //ECON.-EKOROMSKA POLITIKA// 28/04'11975FV--- N---- PP 0023-0025 VICE PRESIDENT 4 FEDEAAL EXECUTIVE COUNCIL DISCUSSES DEVELOPMENT PLANNING 7 PP JPRS 65M N SEFER BERISLAV 11TAJUG DOMESTIC SERVICE// 13/10/1975 V---- N---- SEFER ECOi6MIC A~ORT ~O FEDERAL ASSEMBLY 6 PP FOIS-EEU-75-201 16 OCTOBER L975 SEFERYAN R. //PLW6VOYE KHOZYAYSTVO// 00/07/1976PV---- NOOG7 PP 0122-0126 DISCUSSION Of THi DYN4ICS OF CONSUMER DEMAND 7 PP GUO JPRS L/6546 9 SEGAL, RODICA //INDUSTRIA ALIMENTARA// 00/00/1973fVO024 N0003 PP 0129-0133 QUALITY PROGNOSIS IN iAE FOOD INDUSTRY DISTRIBUTION LIMITED TO U.S. GOVERNMENT ONLY FSTC-HT-23-0563-74 SEGAL,f V. M. //15SLEDOVANIYE PLASTICHESKOGO FORMOIZME- NENIYA METODOM MUARAI METALLURGIYA// OD/00/1974,,V--- N ---- If PP 0001-0196 STUDY ON PLASTI?FORMING OF METALS BY THE zKOIRE-METHOD 266 PP GUO COPYRIGHT MATERIAL OTHERS REFER TO FTD AIRIFTD-MT-24-0623-75 SE6ALEN1 J. 11LA RECHERCHE// 00/06/1974,f V ---- 110046..~ PP 0531-0534 ELECTRONIC WORFARE (EXCERPTS) FSTC-HT-23-188-75 000000005874 000000023842 000000003921 000000028862 000000026168 000000056628 000000011324 000000015130 000000047758 COMPUTATION METHOS APPLIED TO THE LENGTHS OF TEXTURIZED YARN SKEINS NTC 74 13055-11E S EG UR Ao, M. //REVUE. -REVISTA DE INVESTIGACIONES GANADERAS// 00100/1963,,V--~~;NO016 PP 0059-0070 INACTIVATION1 SERVi~ION AND CULTURING OF FMD VIRUS IN KIDNEY CELLS *NTIS TT 76-53395 SEGURA, M. //REVUE. -REVISTA DE INVESTIGACIONES GANADERAS// 00100/19631V ---- rN0016 PP 0059-0070 INACTIVATION CONSERV4ION AND CULTURING OF FMD VIRUS IN KIAEY CELLS *NTIS TT 76-53395 ---SEHlER# W. //ELEC. -ELEKTROTEKHNI KAI/ 00/00/1973, V0025f N---- 0367-0369 SOIRREL-C E WINDINGS iHPEIPR STRESSES AND THEIR TYPES OF CONSTRUCTION NTC 76-13065-09C SEHER, W. tTELEC.-ELEKTROTECHNISCHE ZEITSCHRIFT B// W100/19730V0025 N0014 PP 0367-0369 SQUIRREL CAGE WI6ING?THEIR STRESSES AND THEIR TYPES Of CONSTRUCTION C. E. TRANS 6868 SEMNALOVA, J. //USTAV VEDECKO TECHNICKYCH INfORMACII PRAGUE -SBORNIK GENETIKA I SLECHTENI// 00/00/1973,,VM NM PP 0303-0310 KEY FOR THE IDEN~IFICAION OF CULTIVATED AND WILD WHEAT SPECIES (TRITICUM L.) -W-LC-16139 9 SEHRAf PARMJIT SINGH //METEOROLOGIYA I GIDROLOGIYA// 00/00/1975,rV-~;jN0008~pPiP 0039-0045 COMPARISON OF ATMO HERIC PARAMETERS BY, THE ROCKET- SOUNDING DATA IN THE ANTARCTIC AND NEAR THE EQUATOR 8 PP JPRS 66Z63 SEHRAr PARMJIT SINGH ,//METEOROLOGIYA I GIDROLOGIYA// 00/00/1975,,V ---- fN0008,, PP 0039-0045 COMPARISON OF THE ATMOSPHERIC PARAMETERS BY THE ROCKET SOUNDING DATA IN THE ANTARCTIC AND NEAR THE EOUATOR 8 PP JPRS 66263 SEISEL, W. //DEUTSCHE LEBENSMITTEL-RUNDSCHAU// 00/00/1975,.VW 1.,NO007 PP 0241-0246 THE CONTRIEWTION OF 84AD TO CORRECT NUTRITION TT 77-59096 SEIST KURT 11N&~ WEG// 00/00/1975 V0030 N0016 PP 0127-0730 PARtTY AUDNNG PAOSLEWS DISCUSSED 6 PP JPRS 65984 000000048442 000000052845 000000064969 000000035579 000000041459 000000019772 000000019263 000000071204 000000041121 SEIDEL,, DIETMAR 000000051241 //STAAT UND RECHT// 00/05/19761V0025 N00050 PP 0521-0530 REPORTS ON COUNCIL FOR POLITICAL SCIENCE AND LAW RESEARCH, COUNCIL' S RESPONSIBILITIES REVIEWED pp JPRS 67565 SEIDEL E. ; 000000000691 //FEL WIRTSCHAFT// 00/05/1974 V----,,N ---- , PP 0197-0199 4 SOIL IVlPR EMENT MEASURES FOR CROP PRODUCTION STR E 11 Pp JPRS 62469 SMELt E. 000000020752 /IFELDWIRTSCHAFT // I 00/05/1974pv Pp 0197-0199 --ia SOIL IMPROVE A MENT ME ES FOR CROP PRODUCTION STRENGTH 11 PP JPRS 62469 SEIDEL,, E. 000000035639 //FELDWIRTSCHAFT/I 00/05/1974 V--- N---- PP 0197-0199 ' ' 6 SOIL IMPR EMENT MEASUR ES FOR CROP PRODUCTION STRENGTH 11 PP JPRS 62469 SEIDEL G. A 00GO00009756 /ISC EISSEN UND SCHNEIDEN// 00/00/1971 V--- N0010 PP 0410-0411 ' i' i' INVESTI6A lON OF ELEC ROSLAG WELD CLADDING WITH STRIP ELECTRODES SISI 12188 SEIDEL, H. 000000044295 //TUBERKULOSEARZT// 00/00/1960f V0014 N ---- p PP 0675-0686 RESPIRATORY DISE SES CAUSED BY DESMODUR NTC 74-13289-061 SEIDEL, HANSDIETER 000000052953 //SOLDAT UND TECHNIK// 00/11/1975 V---- N---- PP 0548-0551 ' ' USE OF THiLUCHS ARMOR ED RECONNAISSANCE VEHICLE (WITH AN INTRODUCTION "THE LUCHS APC: MOTHER STEP IN THE MODERNIZATION OF THE BUNDESWEHROO BY ---JaLCHEIF OF STAFF, MMY (OUNDEAWEHR) HILDEBRAND FSIC-AST-11201-011-75 SEI DELf 1. 000000010661 //BEITRAEGE ZUR KLINISCHEN CHIRUGIE// 00/00/1972/0219fN0006, PP0532-0537 SERUM CHANGES ASSOCIATED WITH LIVER METASTASIS RTC- 74-12677-06E SEI DELf K. 000000027607 IIVESTNIK AADEMII MEDITSINSKIKH NAUK SSSR// 00/00/1975 V---- N0009 PP 0068-0071 ' INFORMATION THEOR Y AS4CTS Of PATHOGENESIS OF SCHIZOPHRENIA 3 PP JPRS 66414 SEIDEL,# Kv 000000072541 //NATURWI SSENSCHAFTEN// 00/00/1975 V0062 N---- PP 0300 A M IS THERE ENZY E ACTION OF THE MATERIAL SPERARATED FROM ROOTS IN THE PRECIPITATION .7-or EFFLUENT FROM THE MANUFACTURE OF RUM. 1PP ORNL TR-4123 SEIDELO, K. 000000049550 //NATURWISSENSCHAFTEN// 00100/1975 V0062 N03001 ' is THERE A ENZY ME ACTION OF THE MATERIAL SEPARATED FROM ROOTS IN THE PRECIPITATIO EFFLUENT FROM THE MANUFACTURE OF RUM? ERDA ORML TR-4123-76 SEIDEL, KARL-flEINZ 000000021539 //CHEM. -CHEMISCHE TECHNIK/l 10/06 /19751 V ---- fN ---- I PP 0323-0327 DEFECTS IN CHEMICAL INSTALLATION CONSTRUCTION ANALYZED 9 PP JPRS 65842 SEI DL,, R. 000000003585 //ACTA PHYSICA AUSTRIACA/1 00/00/1957,,V0010 N---- PP 0402-0406 N PROPERTIES OF TH LAYERS OF COPPER AND IRON 9 Pp FSTC--HT-23-236-74 SEIDOV D. G. i' 00OOdOO50230 //ME EOROLOGIYA I GIDROLOGIYA// 00/06/1976 V---- N0006 PP 0067-0071 ~ E .140TION OF ARTIC ES INA STATIONARY JET STREAM 6 P GUO JPRS L/6411 SEIFERT., H. S. H. 000000024035 //TAOPENLANOWIRTI/ 00/00/1973fVOO74 N---- PP 0017-0034 ' ACQUIRED D INiiiITED RESISTANCE OF CATTLE TO INFECTIONS WITH TICKS NTC-.75-11607-02E SEI-F ER T,. K. 000000050668 11AFAM ARBEITSGRUPPE FUER ANGEWANDTE MATERIALFO RSCHUNG// 00/00/1974.fV ---- If N ---- I REPORT 91 STUDIES ON WELDS OF TWO HIGH-TENSILE CONVERSION HARDENING STEELS USING FILLER METALS OF THE TYPE GUO. COPYRIGHT INFORMATION OTHERS CONTACT FSTC ARM/FSTC/nT-23-957-74 SEIFFERTf REINHOLD 000000062000 //GUTE FMRT// 00/00/19761V ---- fN ---- I PP 0022-0028 GOLF DIESEL 6 PP ACSI K 6829 '-_SEI FRITZ,, W. 000000031317 //SCHWEIZ ERI SCHE VEREININGUNG FUR ATOM ENERGIE BEILME ZUM BULLETIN// 00100/1975 V---- NOO101 f f NO ENGLISH TITLE *TIC SEIFR17Z W. 0GO000019987 //SCHWEiZERISCHE VEREINviGuN FUER ATOMENERGIE S ONDERDRUCK AUS SVA-BULLETIN// 00/00/1975fV ---- fNOO10 FUSION REACTORS AS A F~TURE ENERGY SOURCE ER D/UCR L/TR AN S-10940-75 SEIKIGUCHI,, H. / /Y UKAG, AKU / / 00/00/1975, V00241# N ---- IPP 0311-0313 INDIVIDUAL REMOVALS OF ANIONIC SURFACTANTS ------+N MUNICIPAL SEWAGE TREATMENT PLANTS NTC 76-10162-138 SEINO f L //DENSHI SHASHIN// 00/00/197O..Vooog N00021 PP 0057-0063 PERSISTENT INTER;AL PPLARIZATION OF ANTHRACENE CRiSTALS ATS-JS-276 SEITZINGER, K. //SCHKIERTECHNIK UND TRIBOLOGIE// 00/00/1972,fVO019 N---- PP 0145-0148 LIKITE AND POSSIELITAS OF THE,FZG GEAR BRACING TESTING MACHINE.. ESPECIALLY FOR THE TESTING Of HYPOID GEAR OILS PART 5. THE EROSIVE LOAD TESTING OF HIGHLY COMPOUNDED GEAR OILSI ACCORDINGTO THE FZG-L42 TEST NTC 75-10132-11H SEJO SAZAN //TIRMA SASHKIMI// 12/05/1977 V--;4---- PP 00 NO-CONFERACE MEETIk CAN CURE THE SEVERE CRISIS OF THE CAPITALIST WORLD VOL Ilf No 95 17 MAY 1977 fOIS-EEU-77-9s SEKANINAo VACLAV //PRACE A MZDA// 00/11/1975,fV --- ?NOO12 0648-0655 WAGE DEVELOPMEN IN CEWPOUNTRIES COMPARED 9 PP JPRS 66690 SEKAWIN N. //CELLbLOSA E CARTA// 00/00/1974fV0025 N---- PP 0003-0012 CORRELATIONS SET~EEN SPEED Of DEHYDRATION AND ROOT114G ABILITY OF POPLAR CUTTING *NTI S-IT-77-53352 SEKERA, VACLAV //DEMOGRAFI E// 00/10/1975,,V ---- tNO004t PP 0314-0323 OCI-DEC 75 SOME ASPECTS OF GYPSY PROBLEM,, CONDITIONS OF GYPSY SETTLEMENTS 14 PP -JPRS 67690 SEKERZ)i-ZEN'KOVICH,, Y A. E. 110N THE THEORY OF STATIONARY CAPILLARY WAVES OF FINITE AMPLITUDES// ..,.,-00/00/0000 V---- PP 0027-0049 ON THE THEUY OF'STATIONARY CAPILLARY WAVES OF FINITE AMPLITUDES CSO $344/1358-76 COMPLETED SPECIAL SEKERZH-ZEN'KOVICHI YA. 1. //DOKLADY AKADEMII NAUK SSSR// 000000066339 0000G0030155 000000028671 000000068992 000000034672 000000073861 000000055799 000000032989 000000006235 00/03/1974 V0215 N0001 PP 0068-0071 STEADY-S7AE CAPHLARY~GRAVITY WAVES Of FINITE AMPLITUDE CAUSED BY A PRESSURE PERIODIC ALONG THE SURACE Of A LIQUID ABOVE A WAVY BOTTOM Co. SEKERZH-ZEN'KOVICHO YA. 1. //DOKLADY AN SSSR, SOVIET PHYSI.CS// 00/11/1975fVO225?N ---- I PP 0063-0066 ON THE THEORY OF COMPOSITE STEADY CAPILLARY- GRAVITATIONAL WAVES OF FINITE AMPLITUDE ON THE -SURFACE OF A LIQUID OF FINITE DEPTH Al P SEKERZH-ZENKOVICH, YA. 1. //DOKLADY AKADEMII NAUK SSSR// 00/00/1975,902201N00051 PP 1038-1041 ,THEORY OF COMPOUNG STEADY CAPILLARY GRAVITY WAVES OF FINITE AMPLITUDE AIP SEKIGANAO, EIICHIRO .//AVIATION MAGAZINE INTERNATIONAL// 01/10/19?6fV----,N ---- 0 PP 0022-0028 1-14 OCT 76 NATIONAL AEROSPACE INDUSTRY DETAILED 12 PP Guo JPRS L/6598 SEKIGUCHII He //EUROPEAN POLYMER JOURNAL// 00/00/1974,VD010 N---- Pf 1185-1193 PROPERTIES AND MiCHANI'SM OF THERMAL DEGRADATION OF POLYOUTANAMIDE NTC 75-13179-07C SEKIGUCHII He //YUKAGAKU// 00/00/1975f V00241 N ---- I PP 0311-0313 INDIVIDUAL REMOV LS OF ANIONIC SURFACTANTS IN MUNICIPAL SEWAGE TREATMENT PLANTS NTC 76-10162-13B SEKIGUCHII He //YUKAGAKUI/ 00/00/1975f V0024 N ---- f PP 04.78-0480 SURVEY ON DETERGST CONVERSION TO BIO- DEGRADABLE SURFACTANTS IN JAPAN NTC 76-10161-138 SElI GUCHIP Me 11YUKAGAKU11 00/00/1975?VO024 N---- PP 0671-0674 STUDIES ON ADS04TION ~ND BIODEGRADATION IN THE COURSE OF OLEFIN SULFONATE BIODEGRADATION NTC 76-10159-07A SEKIGUCHI" He //YUKAGAKU// 00/00/19751VO024fN ---- PP 0675-0679 STUDIES ON THE RELATIVE BIODEGRADATION RATE OF ALKENE VS. HYDROXYALKAXE SULFONATES IN OLEFIN SULFONATF NTC 76-10160-07A SEKIGUMI,, We 000000048920 000000031897 ON000067851 000000059877 000000067163 000000066334 000000066034 0 00000066035 000000053756 //HOKURIKU BYGGAICHU KENKYU KAIHO// 00/00/19741VO022 N---- PP 0025-0029 ON THE EFFICIENtY OF ~HE SWEEPING METHOD BY COMPARISON WITH THE,SIGHTING METHOD ON THE GREEN RICE LEAFHOPPER, NEPHOTETTIX CINCTICEPS UHLER NTC 75-12842-02D -SEXIMARA.. K. 000000074113 //ANALYTICAL RESULTS OF INFRARED RADIATION OBSERVATION IN THE LOWER STRATOSPHERE. SYMPOSIUM ON THE IONOSPHERIC REGION. PROCEEDING// 00110/19 741V ---- FN ---- I PP 0138-0141 24-26 OCT 1974 ANALYTICAL RESULTS OF INFRARED RADIATION OBSERVATION IN THE LOWER STRATOSPHERE. SYMPOSIUM ON THEIONOSPHERIC REGION. PROCEEDING *AIR FORCE GEOPHYSICS LABORTORY SEKIMOTO? ~//TETSU TO HAGANE// 00/00/19751VO06lfNO010 PP 2337-02349 EFFECT OF ROLUNG COND~IONS ON THE SURFACE TEMPERATURE OF WORK ROLL IN HOT OT STRIP KILL *BISI 13863 SEKIMOTO,, Y. //TETSU-TO-HAGANE// 00/00/1975,V0061 N0010 PP 2337-2349 EFFECT OF ROLLIN6 CONDiTIONS OF THE SURFACE TEMPERATURE OF WORK ROLLS IN HOT STRIP MILL BIS~f 13863 SEKINE, N. //SOKKO JIHO// 00/00/1972 V0039 N---- PP 0113-0120 AN ARTIFICIAL LItHT SO'LAR RADIATION RECORDER TESTING APPARATUS (INTEGRATING SPHERE PRINCIPLE) NTC 76-13680-040 SEXINE, T. //ANALYTICAL// 001 /1971 V---- ANANTI CAL' FUNCTHNS R&RESENTING RESPONSE FUNCTIONS OF NAI(TI) DETECTOR SYSTEMS OF GAMMA RAYS ORML TR 2941 SEKITAf H. //SHOKUHIN EISEIGAKU ZASSHI// 00/00/197910011fN0005 PP 0361-0368 THE ISOLATION AND DET&INATION OF DIPHENYL CHLORIDE FROM ANIMAL TISSUE AND ITS DISTRIBUTION IN WHITE RATS NTC 75-11053-07C ~-..;--SEKOWSKlf S. //MLODY TECHNIK// 00/00/1974,,V0024 N0005 PP 0033-0043 UNITRA TORAL OR ~RINT6 CIRCUITS 15 PP AIR /FTD-I D(R S) 1 -1996-75 SEKTOROVP Vo R* //ELEC. -ELEKTRI CHESTOV// 00/03119530# V ---- IN00031 PP 0011-0016 U H HERGY OF THE WIND FOR ELECTRIFICATION. F-LNAL REPORT 18 PP ERDA-H-74-16801 000000042428 000000058490 000000070765 000000043892 000000022701 000000028105 000000054739 SEL'SKIIO 0. 1. // STAL'// 00/00/1976..V ---- PNO0100 PP 0958-0960 DETERMINING THE LOSSES OF METAL DUE TO OXIDATION IN THE PRODUCTION OF ROLLED STOCK FROM INGOTS *qISI 15265 SEL' SKIY,, B. 1. // STAL' // 00/00/1976#,V---- N0010, PP 0958-C060 DETERMINING THE tOSSES OF METAL DUE TO OXIDATION IN THE PRODUCTION OF ROLLED STOCK FROM INGOTS BISI 15265 SELjSKIY 1. // ZVESiIY`.A VUZ CHERNAYA METALLURGIYA/1 00/00/1975,V----..NG004,, PP 0058-0062 ASSIMILATION OF CARBON WHEN INJECTING POWDERED CARBONIZERS INTO THE METAL *BISI 13517 sELSKIY, V. 10 //I ZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/00/1975 V----,,NG004,, PP 0058-0062 ASSIMILAT16N Of CARBON WHEN POWDERED CARBONIZERS INTO THE METAL J31SI 13517 SEL' SKI Y? V. 1. //IZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/00/1975 V--- N0004., PP 0058-0062 ASSIMILATI6N OF CARBON WHEN POWDERED CARBONIZERS IN,TO THE METAL SISI 13517 SEL'SKIY, V. 1. //IZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/00/1975,V-- - NMI PP 0058-n2 ASSIMILATION O~ tARBON WHEN POWDERED CARBONIZERS INTO THE METAL BISI 13517 SELA,, AMNON I/DAVAR// 01 /04 11977f V ---- PP 0018 ALSO P 27 ANALYSIS OF STATE'S MILITARY OPTIONS 7 PP JPRS 68028 SELANDER, TOM //SVENSKA DAGOLADET// 00/01/1974fV ---- fN ---- I 16 19 JAN 1974 T6 A6ENT MAKES DISCLOSURES 15 PP CSO: $050/1472-75 COMPLETED SPEICAL SELEMENEV S 1 //DOKLADI TiMlilAZEVSKAIA s-rH AKADEMIYA// 00/00/1975,V----,,NO205 PP 0153-0155 INCREASING THE EFFECTI~ENESS OF UTILIZATION OF FEEDS BY ARTIFICIALLY-BRED LAMBS *xTlS 11 76-58210 SELENEW/ Wo //PLASTE KAUTSCHUXII 000000065168 000000062514 000000043646 000000019072 000000019581 000000036699 000000064794 000000024023 000000068207 000000020369 00/00/19720,VOO19 N---- PP 0263-0268 INFLUENCE Of FILtERS UPON THE PHYSICAL. PROPERTIES OF SOLID POLYMERS NTC 74 13112-111 SELENICAI ELENI /IRRUGA E PARTISE// 00/05 /1975, V ---- IN ---- I PP 0055-0063 SHORTCOMINGS IN IMPLEMENTATION OF LAWS 9 PP JPRS 65514 SELEZNEVF- D. //AVIATSIYA I KOSMONAVTIKA// 00/04/19?5,V----,NO004 PP 0030-0031 PROBLEMS OF SERVICING kW AIRCRAFT DISCUSSED 5 PP JPR S 649 27 SELEZNEV, G. K. //LATINSKAYA AMERIKA V BOR'OE PROTIV REAKTSII I NEOKOLONIALIZMA// 00/00/1976,.V---- PP 0001-0002 ALSO PP 3-11 24-280 1 LATIN AMER16 IN THE STRUGGLE AGAINST REACTION -AND NEOCOLONIALISM 23 PP GUO JPRS L/7092 SELEZNEV S A. //VESTNfK iKADEMII MEDITSINSKIKK NAUK SSSR/l 00/00/1974,,V-~~; ND010, PP 0028-0032 ORGAN OXYGEN GUMPTION IN SEVERE TRAUMATIC SHOCK AND RELATION THEREOF TO CIRCULATORY DISORDERS 6 PP JPRS 63877 SELEZNEV V. //IZVESiY'-A CHERNAYA METALLURGIYA// 00/00/19?6fV ---- INOC107 PP 0101-0106 FORCE COND TIONS DUR14 THE HOT ROLLING OF STAINLESS STEEL INGOTS PRODUCED BY VARIOUS METHODS OF MELTING BISI,14907 SE.LEZNEVI YURZY //MOSKVA// 00/03/1976,V---- H0003 PP 0201-0208 KAZAM POET WAS SUL'EYMENOV ON ORIGINS OF RUSSIAN CIVILIZATION, MY-THS AND TRUTHS 16 PP GUO JPRS L/6094 SELEZNEVAO, 1. K. //GORENIYE I VZRYV// 00f00/19721 V ---- IN---- PP 0396-0400 SPHERICALLY SYMMETRIC 6PTICAL DISCHARGE AS ANALOG OF DIFFUSION COMBUSTION IN THE MIXTURE OF FUEL GASES FTO-MT-24-1931-74 --SELFZNEVAI 1. //PLAMOVOYE KNOZYAYSTVO// 00/00/1976fV---- M00061 PP 0128-0135 CALCULVIONt. FORfmATION OF SOME INDIRECT EXPENDITURES 10 PP GUO JPRS L/6289 SELEZNEVAI T. 65, I 000000025701 0000000131?4 000000064791 000000002559 000000065306 000000054123 000000034215 00NO0049277 000000017897 //TSITOLOGIYA I GENETIKA// 00/00/1973 VOOO? N0003 PP 0244-0247 SENSITIVIT~ Of HbMAN ChTURED LYMPHOCYTES AND TUMOR CELLS TO THE MUTAGENIC EFFECT OF N-NITROSO-N-METHYLUREA' AND ETHYLENEIMINE DERIVATIVES NTC 75-11563-06P SELEZNOVf V. P. //NAVIGATSIONNYYE USTROYSTVA// 00/00/1974.1 V---- N ---- t PP 0476-0505 NAVIGATION DEVIAS _7G UO CSO: 8344/0201 JPRS L/6674 SELEZOV, 1. 1. //MAGNITNAYA GIDRODINAMIKA// 00/00/1974 V---- N0002 PP 0041-0046 PKOPAGATIA OF TAAVELikWAVES IN A OQUID ELECTRICALLY CONDUCTING WAVEGUIDE SURROUNDED BY AN ELASTIC DIELECTRIC NISC 3639 SELIDOVKIN., 0. //ZHURNAL MIKROBIOLOGII EPIOEMIOLOGII I IMMUNOBIOLOGII// 00/08/1975,V---- N0008 PP 0086-0089 EXPERIENCE IN THi USE 6F JET INJECTORS FOR MASS IMMUNIZATION AGAINST INFECTIOUS DISEASES 12 PP GUO COPYRIGHT INFORMATION REFER OTHER REOUEST TO FTD/STINFO AIR /FTO-ID(RS) 1-0990-76 SELIFONOV V //ZA RULW~ 00/00/19731V ---- PNO001 PP 0001-0003 A FIRM BASIS FOR SOVIEi MOTOR VEHICLE CONSTRUCTION FSTC-HT-23-1379-73 SELIGER,. H. //BERG- UND HUTTENMAENNISCHE MONATSHEFTE// 00/00/1973,,V00001 N0118 PP 0013-0023 WORK STUDY IN STEiLWORVDS PROBLEMS AND EXAMPLES BISI 12121 SELIGERp KURT //OSTEUROPA// 00/04 11975f V---;,, N---- PP 0235-0245 ALBANIA-CHINA R LATIONISHIP DISCUSSED 14 PP GUO JPRS L/5334 SELIGMAN, NOAM C. //NITUACH rjEO-807ANI KAMUTI SHEL ZOMAYACH HAOOLAN// V 00/00/19730 0002-0005 M L__? ALSO 106-118- ~tNEG NDPp A QUANTITATIVE GEODOTANICAL ANALYSIS OF THE VEGETATION OF THE GOLAN CSO $124/1167-76 COMPLETE SPECIAL SELIKHOVf YJM //PO SLEDAM DZHI-AY// PP 0001-0002 ALSO PP 142, 31 132 133, 134-141 000000067317 000000011028 000000059072 000000010830 000000021352 000000012989 000000041981 000000059375 BOOK DISCUSSES AMERICAN SERVICEMEN 11 PP GUID JPRS L/618Z SELIM0, H. //NACHRICHTENTECHNISCHE ZEITSCHRIFT// 00/00/1974 V0027,N----, PP 0225-0229 THE OPTIMIiATION OF THE SAMPLING POINT OF THE ADAPTIVE TRANSVERSAL FILTER EQUALIZER NTC 73-10657-09A SELIMF M. M. //DOKLADY AN SSSR PHYSICAL CHEMISTRY// '00/10, 1975 V0224 NbOO5 Pp 1119-1121 /THE FORM 1; WHICA HYDROGEN IN INTRODUCED INTO THE STRUCTURE OF VARIOUS ZEOLITE CATALYSTS OF TYPE Y CB ~.ELIMOVO, M. A. //VOPROSY VIRUSOLOGII// 00/00/1970,.VO0151NO0021 PP 0161-0165 ON RCT40-MARKER FIXED RABIES VIRUS NTC -75-10141-06M SELIVANOV,f A. S. //KOSMICHESKIYE I SSLEDOVANI Y A// 00/00t1975 V00131mooolf PP 0060-0066 JAN. -FEB 1~75 INSTRUMENTATION AND SOME RESULTS OF PHOTO- GRAPHIC STUDY ON BOARD THE MARS-4 AND MARS-5 AUTOMATIC STATIONS NASA TT F 16342 SELIVANOV A. S. l/TECHl.'iEKHNIKA KINO I TELEVIDENIYA// 00/00/1977fV ---- 1000031f PP 0043-0045 TELEVISION UNITS ABOARD EXPERIMENTAL SATELLITES 6 PP GUO JPRS L/7.151 SELIVANOV, A. V, I/VETERINARIYA/I 00/00/1970,V ---- fN0002f PP 0034-0036 SURVIVAL OF THE BUK VACCINE STRAIN OF THE AUJESZKY .01-SEASE VIRUS IN THE AEROSOL STATEPP 10 AIR /FTD/10(RS) 1-1035-76 SELIVANOV A. V. //DOXLAD~ VSESOYUZNOY AKADEMII SEL'SKOKHOZYAY STVENNYKK NAUK IMEMI V. I. LENINA// 00/01 /1975f V---- N0001 PP 0028-0029 RETENTION AND DISTRIWION OF A VACCINE AEROSOL IN THE LUNGS OF AGRICULTURAL ANIMALS. 10 PP GUO COPYRIGHT INFORMATION REFER OTHER REQUESTERS TO FTDtSTINFO AIR /FTD-ID(RS) 1-0760-76 ------ StLIVAROVI A, V, IIVETCR114ARIYAII .00/00/1971tv---- mOO02 PP OW-0011 PROMISIN6 METHOU'S FOR IMMUNIZING ANIMALS 6 PP JFRS Lt7O58 SELIVANOV/ 1. 000000022838 000000058351 0000000217 24 000000024465 00000M9283 000000062087 000000055338 000000033318 //LENINGRADSKAYA PRAVDA// 11 /11 /19751 Pp, 0002 W COOPERATIVESP OTHER FO OF AGRICULTURAL ORGANIZATION DISCUSSED, RUl ~AL PRODUCTION PROBLEMS 6 PP JPRS 66608 N SELIVANOV, V. G //TSVETNAYA ME~ALLURGIYA// 00/00/1960,V ---- 00003 PP 0112-0114 1 THERMAL ANALYSIS OF THt SYSTEMS KBF4 AND NABF4 -NAF-B203 ERDA/ORNL-TR-2940-?5 SELIVANOVP V. N. -L/LATINSKAYA AMERIKA// 00/00/19760,V ---- INO0031 PP 0070-0084 NAY-JUN 76 U.S. EXPANSION INTO LATIN AMERICA 16 PP GUO _ JPRS 1/6361 SELIVANOV V. N. //LATIN~KAYA AMERIKA// 00/00/1976f V____j N0003f PP 0070-0094 - MAY JUN 76 0 S. EXPANSION INTO LATIN AMERICA 16 PP G~; JPRS L/6360 SELIVANOVAt & S. //DOKLADY AN SSSR.. BIOCHEMISTRY// 00/09/1974,0218 mOGO2. PP 0493-0496 K SYNTHESIS AND S DY OF THE TOXIC PROPERTIES OF CERTAIN ORGANOARSENIC COMPOUNDS Ce SELIVANOVA.. L. F. //CHEM. -KHIMI CHESKIE VOLOKNA// 00100/19741V---- M0005 PP 0047-0050 4 4 NON-UNIFORMITY A FE PROPERTIES OF POLY ACRYLONI TRILE FIBER NTC 16-IM6-IIE SELIVANOVA, L. N. 11161GIVENA TAU0A I PROFESSIONALNYE ZABOLEVANIYA// 00/00/1961/V ---- fN0OO6f PP 0026-0029 TOXIC17Y OF FINELY DISPERSED METALLIC NICKEL DUST WHEN INHALED REPEATEDLY 14TC 75-113Z541 SELIVANOVA, Lo N. //GIGIYENA TRUDA I PROFESSIONALNYE ZABOLEVANIYA// 00/00/1961, V,-! --- I NOO06/ PP 0026-0029 TOXICITY OF FINELY DISPERSED METALLIC NICKEL DUST WHEN INHALED REPEATEDLY NTC 75-11325-061 SELIVERSTOVO A. S. //TRUDY PIRRO/I 00/00/1969,,V0025 N----.. PP 0064-0C90 A VELOCITY OF THE ERRING LARVAE DRIFT ON SPAWNIW, GROUNDS IN THE WEST DKANDIA SHELF AR EA *NTI$ IT 76-52008 000000047740 000000057098 000000057106 000000021655 000000067506 000000057543 000000040958 000000044056 SELIVERSTOV, A. S. //MATERIALY RYOOKKOLYAISTVENNYKM ISLEDOVANII SEVERNOGO BASSEINA// 00/0011970 V--~;ENO016, PP 0240-0253 VELOCITY AD 0 CTION OF HERRING LARVAE DRIFT IN THE AREA OF THE NORWEGIAN SHALLOWS IN'MARCH-APRIL 1968 *NTIS TT 76-52007 SELIVERSTOVp V. //SOTSI ALI STI CHESKAYA INDUSTRIYA// 09 109 11975f V---- N---- PP 0002 PROBLEMS IN PRICING, PRODUCTION OF COTTON PRINT CAUSE SHORTAGE 5 PP JPRS 65844 SELIVERSTOVI V. A. //DOKLADY AN SSSR,, GEOLOGY// 00/00/1974fV021710002 PP 0424-0427 MEYMECHITE IN THE NORikRN PART OF THE VALAGINSKIY RANGE, EASTERN KAMCHATKA AGI SELKOV, 0. M. //ZAHRANICNI OBCHOD// 00100/1976 V---- N0004 PP 0015-0017 ECONOMIC C60PERAION BfTWEEN SOCIALISTI DEVELOPING COUNTRIES VIEWED 8 PP JPR'S 68464 SELL, J. //HOLZ ALS ROH-UND WERKSTOFF// 00/00/1973fVO03lfN---- PP 0124-0127 WEATHER PROOFING OF W06D WITH IMPREGNATION PAINTS NTC 74 13177-11L SELLARS, C. M. //REVUE.-REVUE DE LA METALLURGIA MEMOIRES SCIENTIFIQUES// 00/00/1966f V00631 NOON PP 0731-0746 RELATIONSH P BETWEEN S%ENGTH AND STRUCTURE IN DEFOR14ATION AT ELEVATED TEMPERATURE *FSTC AST-18401-042-75 SELLARS, C. M. //REVfJf.-REVUE METALLVRGIE MEMOIRES SCIENTIFI QUES// 00/00/1966010063fNC1009f PP (Y731-0746 -THE RELATION BETWEEN RESISTANCE AND STRUCTURE IN DEFORMA71ON AT HIGH TEMPERATURE ER DA SELLARS C. M. - //MEi;RIES SCIENTIFIQUES DE LA REVUE DE METALLURGIE,, LES// 00/00/196610063100~ PP 0731-0746 RELATION BETWEEN STRENGTH AND STRUCTURE IN HIGH TEMPERATURE DEFORMATION ERDA DP-TR-5 SELLNtSf C. M. //MEWJIRES SCIENTIFIgUES REVUE METALLURGIE// 00/00/1966fV0063100091 PP 0731-0746 RELATIONSH P BETWEEN STRENGTH AND STRUCTURE IN DEFORMATION AT ELEVATEU TEMPERATURE 32 PP 6UO COPYRIGHT INFORMATION REFER OTHER REOUEST TO FSTC . ARM/FSTC/AST 18401-042-75 000000044055 000000021548 000000024496 000000055026 000000020386 000000048324 000000061573 000000065788 000000071705 SELLING SCHEGG D. 000000059006 /VKERNFORSCHtNGSZENTRUM KARLSRUHE// 00/01 /1976, V---- m COST OPTIMAL LIFFTEST'FOR COMPONENTS WITH EXPONENTIALLY DI -STRI8UTED LIFETIMES 65 PP ERDA/SAND-76-6013 SELLINSCREGG, D. 000000019403 //ZUR BESTIMMUNG KOSTENGUNSTI GER LEBENS DAUER EXPERIMENTE FUR ELEMENTE MIT EXPONENTIELLER LEBENSDAUERVER TEI LUNG KERFORSCHUNGSZENTRUM 00/00/1974 V--- N---- PP 0001-0056 KARLSRUHE INSTITUT FUR'ANGEWANDTE SYSTEMTECHNIK UND REAKTORPHYSIK KARLSRUHE UNIV NO ENGLISH TITLE *USERDA TIC SELLINSCHEGG, D. 000000018894 //lUR BESTIMMUNG KOSTENGUNSTIGER LEBENS DAUER EXPERIMENTE, FUR ELEMENTE MIT EXPONENTIELLER LEBEN SD AUER VER TEI LUNG KERFORSCHUNGSZENTRUM 'Ob/0011974 V---- N---- PP 0001-0056 KARLSRUHE INSTITCUT FUR'ANGEWANDTE SYSTEMTECHNIr. UND REAKTORPHYSIK KARLSRUHE UNIV NO ENGLISH TITLE *USEROA TIC SELMARU, TRAIAN //ERA SOCIALISTAtt 00/00/19741V----PN0012 PP 0046-0047 MILITANT ROLE OF ROMANIAN THEATER 5 PP JORS 63021 SELYUNINA, V. //SOTSI ALI STI CHESKAYA INDUSTRIYA// 28 /05 /1975, V ---- fN ---- f PP 0002 INDUSTRIAL MANAGEMENT RE-ORGANIZATION 6 PP JPRS 65121 SELYUNINP Vo //SOTSI ALI STI CHESKAYA INOUSTRIYA// 31/07/1975tv ---- fN---- PP 0002 UNRELIASIL TY OF CONSTkUCTION-COST ESTIMATES 7 PP JPKS 65555 SELYUNIN, V. //SOTSI ALI STI CHESKAYA INDUSTRIYAl/ 24 /06 /19 76f V---- m---- Pp 0002 SH 'H6R TCO' CHEKINO WAGE S MIN6S CRITICIZED 5 PP JPRS 67896 SELYUNIN.0 V. //SOTSIALISTICHESKAYA INDUSTRIYA// 19/03/1977 V ---- IN ...... PP 0001 STATUS OF iHE SHCHEKINO APPROACH TO INDUSTRIAL PRODUCTION EFFECTIVENESS 5 PP JPRS 69003 SELYUTAf A. 1. 11DEN61 I KREDIT/l 00/02/1975 V ---- fNO002f PP 0078-0081 SAVINGS BAK EXPERIENCE IN GAINING INCREASED DEPOSITS 5 PP JPRS 64611 -SELYUTIN/ P, S, //6AZ0VAYA PROMYSHLENNOST// - 00/00/1975f V ---- tNO009f PP 0023-0026 000000003017 000000031990 000000013412 00000M0246 000000064283 00000000" 17 000000060332 THE USE OF AQUEOUS SURFACTANT SOLUTIONS TO INCREASE GAS PRODUCTION FROM WELLS *USERDA TIC SELYUTINP P, SO //GAZOVAYA PROMYSHLENNOST// 00/00/1975..V ---- ON00091 PP 0023-0026 THE USE OF AQUEOUS SURFACTANT SOLUTION TO INCREASE GAS PRODUCTION FROM WELLS *USERDA TIC SELYUZHITSKIY, G. V. //GIGIYENA TRUDA I PROFESSIONAL' NYYE ZABOLEVANIYA// 00/00/1972rV001610006f PP 0046-0047 EXPERIMENTAL DATA USED OT ESTABLISH THE MAXIUM ALLOWABLE CONCENTRATION OF METHYL NTC 75 10990-06J SEMAN., TIBOR //PLANOVANE NOSPODARSTVI// 00/06/1976?V---- #N0006 PP 0011-0018 . ENVIRONMENTAL PROTECT16N PROGRAMS IN SLOVAKIA SEMASHKO., M. 1. //ZHURNAL MIKROBIOLOGII, EPIDEMIOLOGII I IMMUNOBIOLOGII// 00/ 00/ 19 7 3f V ---- IN0006 PP 0023-0027 TOXIC AND SENSITIZING kOPERTlES OF PERTUSSAL MONOVACCINES PREPARED FROM MICROBES OF VARIOUS SEROLOGICAL TYPES NTC 75-13297-06M N -'--SEMASHKOt N. N. //PLAZMENNYE USKORITELI// 00/00/1973..V ---- PN ---- I PP 0301-0309 INJECTION OF INTENSIVE FLOWS OF HIGH- SPEED HYDROGEN IONS AND ATOMS 18 PP FTD-HT-23-1098-74 SEMASHKO Iq N. N. I/ATOMNAYA ENERGIYAl/ 00/00/1975 V0038 N0005 ' O A THE DEVE MENT OF ME S OF OBTAINING INTENSIVE FLUXES OF FAST PARTICLES FOR THERMONUCLEAR DEVICES IN THE USA EAD17R-53-75 SEMAS000, N. N. //ATOMMAYA ENERGIYA// 00/00/19751VO038IM00051 PP 0348-0349 DEVELOPMENT OF MEANS Of OBTAINING INTENSIVE FLUX ES OF FAST PARTICLES FOR IHERMONUCLEAR DEVICES IN THE USA 6 PP ERDA TR-53 SEMAVINA A. N. 7 //s7AL / 0010011976,fV--~N0012f PP 1124-1125 EFFECTS Of THE METHOD WHICH WIRE IS PRODUCED ON THE KINETICS OF WING AND ITS SUSCEPTIBILITY TO LAMINATION *9ISI 15576 SEMBRITZKlf FERO //CHEM, -CHEMISCHE BERICHTE// 0010011889f V0022 N---- PP 2958-2967 i h EN65LI91 TITLE NO GIVE 000000071940 000000022840 000000049345 000000053120 000000005915 000000023532 000000027115 000000071915 000000019976 *NASA TT F-16690 SEMBRI TZ KI FER DI NAND //CHEMISCAE BERICHTEI/ 00/00/18891VO0221N----, PP 2958-2967 ON THE SUCCINIC DIAMIDOXIME AND ITS DERIVATIVES NASA TT F-16690 SEMBRITZKI,, H. / /Ml LI TAER TECHNI K// 00/--/191601 V ---- IN0006,f PP 0248-0250 AIR CUSHION VEHICLES: OPERATION AND DESIGN GUO COPYRIGHT MATERIAL NISC 3845 SENBRITZKI, H. //MILITAERTECHNIK// 00/00/1976,,V ---- IN0006 Pp 0248-0250 AIR CUSHION VEHICLES: b*PER ATION AND DESIGN GUO COPYRIGHT MATERIAL NISC 3845 SEM6RITZKI H. //KILITZECHNIK// 00/06/1976jV----,,N0006.. PP 0248-0250 AIR CUSHION VEHICLES: OPERATION AND DESIGN 7 PP N AV INI S C -TR -38 45 -7 6 SEMCHINKO, YA. I/VOY.-VOYEN?(YYE ZNANIYA// 00/11/1975..V --- ~AN0011, PP 0016-0017 --THREE VIEWS OF E MISSILEMAN-ARTILLERYMAN 6 PP JPRS 66654 SEMCHENKOV 1. //ZHAMENO~ETS// 00/12/19751V---- N00121 PP 0016-0017 DESCRIPTION OF 4AVY INFANTRY FLAMETHROWER TPO-50 5 PP JPRS L/5701 SEMCZUKf ODLESLN //POLSKI TYGODNIK LEKARSKI// 00/00/1967,0024N--- PP 0586-0588 CHANGES OF ACOUSTIC S?NSITIVITY DURING THE MENSTRUAL CYCLE 12 PP 6U0 COPYRIGHT INFORMATI.ON REFER OTHER REQUEST TO FSTC ARM/FSTC-AST 25201-002-76 SEMEMENKOt D. K. //TRUDY VSfSOYUZNOGO NAUCHNO-ISSLEDOVATELSKII INSTITUTE PODLEMNAYA GAZIF UGLEI// 00/00/1960fV---- N0003 PP 0027-0047 OUTPUT RATES OF AOLES DRILLED IN ROWS IN AN INHOKOGENEOUS SEAMO AND THE GAS LOSSES 43 PP (RDA UCRL IR-11141 SEMENCHENKO,. A. YA. //NAUCHNYY KOMMUNIZM// 00/00/1975 V---- N00031 PP 0074-0081 f STUDENT CONSTRUdION DETACHMENTS' ROLE IN COMMUNIS INDOCTRINATION DISCUSSED 11 PP JPRS 65436 SEMENCHENKO/ 0. A. 000000037581 000000063315 000000060393 000000063119 000000033979 000000037114 000000065507 000000065809 000000017049 000000050222 //METEOROLOGIYA I GIDROLOGIYA/1 00/06/19761V ---- IN0006 PP 0092-0096 EFFECT OF CLOUDS ON RAIATION RECEIPTS IN THE TROPICAL OCEAN ZONE 9 PP GUO .JPRS L/6411 SEMENCHIKOV01 V. 000000066811 //AVIATSIYA I KOSMONAVTIKA// 00/02/19771 V ---- IN0002 PP 0010-0011 U STAFF ACTIVITIES IN PORT OF FLIGHT TRAINING 6 PP GUO JPRS L/7124 SEMENENKO D K ' - //T UDY ~SEiOYk Y 000000052816 R N I NAUCHNO I SSLEDOVATEL SKI I INSTITUT PODZEMNOI GAZIFIKATSII UGLEI// 00/00/1960..V---- N0003, PP 0027-0047 9 THE YEILDS OF 80 EHOLES SITUATED IN SERIES IN A NORHOMOGENEOUS COAL BED, AND GAS LOSES *ERDA SEMENENKO D. K ' ~ k 000000060423 //TRUDY SESOY NOGO NAUCHNO-ISSLEDOVATEL SKO GO INSTITUTA PODZEMNOI GAZIFIKATSII UGLEI// 00/00t1960pV---- N0003 PP 0027-0047 ' A OUTPUT RATES OF OLES DRILLED IN ROWS IN AN INHOMOGENEOUS SEAM AND THE GAS LOSSjS ERD/UCRL-TRANS-11A1-76 SEMENENKO D. K ' ~ b 000000057766 //TRUDY SESOY ZNYI NAUCHNO-ISSLEDOVATEL SKII INSTITUT PODZEMNOI GAZIFIKATSII UGLEI// 00/00/19600.V-- PP 0027-0047 N0003 1 ~k THE YIELDS OF EHOLES SITUATED IN SERIES IN A NONHOWGENEOUS COAL BED,, AND GAS LOSES *ERDA SEMENENKOf D. K. 000000060075 //TRUDY VSESOYUZNOGO NAUCHNO-I SSLEDOVATEL' SKOG O INSTI TUTA PODZ EMNOI GAZI FI KATSI I UGLEI 00/00/1961 V---- N0004F PP 0033-0046 ' f METHOD OF NVEST IGATING THE FLOW Of GAS IN A COAL SEAM 24 PP ERDA/UCRL-TRANS-11W-76 SEMENENKO , D. K. 000000016542 //TRUDY VSESOYUZNYI NAUCHNO-ISSLEDOVATEL' SKIY INSTITUT PODZEMNOY GAZIFIKATSIY UGLEY// ]DO/00/1965tV ---- IN00131 PP 0017-0021 CALCULATION OF GAS LOSSES IN JOINT OPERATION OF SEVERAL UNDERGROUND GASSIFIERS AEC /UCR L/TR ANS-1 07912-75 SEMENENKOf 0. K~ 000000008560 //TRUDY VSESOYUZNYl NAUCHNO-ISSLEDOVATELDKII// 00/00/19651V ---- tNO013 , PP 0017-0021 , CALCULATION OF GAS LOSSES IN JOINT OPERATION OF SEVERAL UNDERGROUND GASIFIERS 9 PP Alf UCRL-TR-10792 SEMENERK0 YU //SEL' SWAY A ~Hl ZN// 000000001123 05/10/19741v--~. ---- I PP OD02 MEAT PROCUREMEN4N KRASNOYARSKIY KRAY MUST BE BETTER ORGANIZED 3 PP JPRS 63352 SEMENENKO YU * L //$ L/7 000000058744 TA PP 0634-D637 00/00/1976 V ---- ~000?~ 6 DETERMININ THE ASS 6 OVE AND CURVED O GENERATRIX MANDREL CONTOURS FOR CTR MILLS. BISI 14884 SEMENESCU, MIHAI //ERA SOCIALISTA// 00/0G4V94jV----fNO010 . PP 0023-0025 . NEW WATER MANAGEMENT-LAW DISCUSSED 6 PP JpRS 62668 SEMENKEVICH S ~ R //SOTSIALI T HESKIY TRUD// 00/00/1976.. V---- N0008 PP 0104-0112 I 6 STRENGTHEN NORM 1VE B SE, INTRODUCE TECHNICALLY SUBSTANTIATED NORMS 11 PP GUO ~JPRS L/6541 SEMENKO, V. P. /lUCHENYYE ZAPISKI,TSENTRAL'NOGO ASTRO-GIDRODINAMICHESKOGO INSTITUTA// 00/00/1974,,VO005P N0004 PP 0117-0122 ' I INVESTIGATION Of A SATE LI TE S EQUATIONS OF MOTIO N IN A NONINERTIAL COORDINATE SYSTEM *DMAAC SEMENKOV 0 ' //SOVEi SKi;A BELORUSSIYAJ/ 20/01/1976 V----,,N ---- I PP 0002 S ) COLS 1-4 NO 150359 AUTOMATION OF ENGINEERING LABOR 5 PP AIR /FTD-ID(W 1-0345-76 SEMENKOVp ~V. F. //DOKLADY AKADEMII NAUK SSSR// 00/02/1974 V0214 N0006 PP 1437-1439 A E N CORTICOSTE ONE L VELS INBRED MICE AND IMMUNE REACTIONS AGAINST WEAK TRANSPLANTATIONS ANTIGENS CB SEMENKOVI V, F. //DOKLADY AN SSSR,, BIOLOGICAL SCIENCES// -..-,--%/11/1975 V0225 ND003 PP 0704-0706 iA 6 O STUDY OF E IMM 0L CAL COMPETENCE IN MICE BY THE TRANSPLANT-AGAINST-HOST REACTION cB ' ' SEMENOV A //SOVE KI ~S YE PROF SOYUZY // - GO/DO/1974 V- PP 0033-0035 N0023 , TABOR SAFE~i T DARDS 10 PP ; ~ JPRS 63945 tEMENOVf A. 110DOW fv .... fN ---- t PP 0004 07/09/1975 . COL 1-2 ATTACK ON VIBRATION 4 PP AIR/FTD-I0(R5)I-2Z20-75 SEMENOV o A. , //VOPR SY EKONOMIKI// 0 0 t 00 119 7 61 V - - --,f N 0005 1PP 0150-0153 AC"IEVEMENTS OF SCIENTIFIC INSTITUTIONS Of USSR ACADEMY Of SCIENCES; TASKS 8 PP 000000000756 000000040660 000000009855 000000045346 000000006305 OOOOOON?569 000000002963 000000018404 000000061796 SENENOV A. 000000038188 -.-"Ml R 4 AY AEKONOMIKA I MEZHDUNARODNYYE OTNOSHEN IYA// 0 0 / 01 / 19 7 61 V ---- IN0001 PP 0012-0022 NEW ACHIEVEMENTS OF CE6 INTEGRATION EXPOUNDED 15 pp 6U0 JPRS L/5754 SEMENOVf A. 1. 000000011669 / /PROMY SH LENNOY E STROI TEL' STVO OD/11/1974,v____ N0011 PP 0010-0013 I L EXPERIENCE OF US NG FI ED PILES IN PERMAFROST -GROUND 9 PP JPRS 64383 SEMENOV A. N. ~ 000000071126 //TRUD SELSKOKHOZYAISTVENNYI INSTITUT KISHINEV // 00/00/1966f V0040f N----I PP 0033-0034 RELATION OF DEPTH OF SOIL LOOSENING TO SOME PARAMETERS OF CULTIVATOR SWEEPS NTC 76-13616-02C SEMENOVI A. N. 000000011672 //PROMY SHLENNOYE STR 01 TEL' STVO 00/11/1974d---- N0011 PP 0018-0020 I ' EXPERIENCE OF CREATING ROL AN AUTOMATED CONT SYSTEM FOR BRATSKGESSTROY 7 PP JPRS 64383 SEMENOV, A. P. 000000066126 //ZASHCHITNYYE VYSOKOTEMPERATURNYYE POKRYTIjYAf TRUDY 5-G0 VSESOYUZNOGO SOVESHCHANIYE PO ZHAROS. TOYKIM POKRYTIYAMI KHAR'KOVI 12-16 M AY 1970// , V ---- PP 0121-0126 00/0011972 I , PREPARATION OF H AT-RESISTANT ANTIFRICTIONA'I AND WEAR-RESISTANT COATINGS BY CONTACT EUTECTIC MELTING 9 PP, - i 4 GUO COPYRIGHT INFORMATION REFER OTHER REQUEST TO FSTC ARM/FSTC/1328-75 SEMENOV, A. P 000000040951 //LENIKRADS6YE OTDELENIYE NAUKA// 00/00/1972,v---- IN---- PP 0121-0126 PREPARATION OF HEAT-RESISTANT ANTIFRICTIONAL AND WEAR-RESISTANT COATINGS BY CON ARM/FSTC-HT-23-1328-75 SEMENOVI 0. 000000068353 //RADIO// 00/05/1976 1V ---- INOO05t Pp 0002-0004 NEW GENERATION OF HOME ENTERTAINMENT EQUIP~ENT~ 6 PP GUO JPRS L/6137 SEMENOV B. F. 000000004522 //VESiNIK AKADEMII MEDITSINSKIKH NAUK SSSR// 00/00/1974 V---- NOOll, PP 0038-0040 IMMUNOPATALOGI6L REACTIONS INDUCED WITH #R80VIRUSES 4 PP JPRS 64188 SEMENOVI 0. F. .000000053213 //DOKLADY AN SSSR, EARTH SCIENCES// 00/00/1975 V0220 N0005 PP 1155-1157 OU STOSTROAES OF'LATE PALEOZOIC TO EARLY CRETACEOUS A6E IN SAKHALIN AGI SEMENOVO 6. G //PROBLEKY D~L'NEGO VOSTOKA// OO/OO/19?6,,V----,NOOO2 PP 0185-0201 NOTES OF A MILITARY ADOISER 2 PP GUO ~ JPRS L/6284 ---SEMENOVO, 1. MOMMUNIST VOORUZHENNY10i SIL// 00/03/1977fv ---- ND005, PP 0078-0086 POLITICAL INSTRUCTION ON THE NEED FOR A STRONG -DEFENSE 11 PP 6U0 JPRS Lf7O77 SEMENOV L. F. / tR ADI 681 OLOGI Y A/ 00/00/1974 V0014 NOO030, PP 0429-0431 STATE OF AE REPAODUCTIVE FUNCTION IN MONKEYS THAT HAVE SUFFERED ACUTE RADIATION SICKNESS AEC-TR--7596, PP 144-147 SEMENOV M. //LITEAATURNAYA 6AZETA// 03/03/1976,V---- N---- PP 0014 TOURISM PROSPECT's AFTEk HELSINKI DISCUSSED 7 PP JPRS 67137 -SEMENOVP NO //SOTSIALISTICHESKIY TRUD// 00/00/19751V---- N0001f PP 0033-0040 PIECE-RATE-PLUS4NUS SYSTEM RECOMMENDED 11 PP JPRS 64398 SEMENOVI N. NO //DOKLADY AN SSSR HYSICAL CHEMISTRY// 'NtoP f -1377 00/04/1975fV0221 06 PP 1374 MULTIELECTRON OXIDATION-REDUCTION PROCESSES IN CHEMISTRY- AND BIOLOGY ce skmEmov'f NO NO MESTRIK AKADEMII,NAUK SSSR// O0/O0/1976fV---- I N0001 PP 0061-0074 CHEMICAL KINETICS, PRALEMS AND PROSPECTS 13 PP 6u0 JPRS L/5803 SEMENOVI NO NO /IVESTMIK AKADEMIl NAUK SSSR// 00/00/1976 V ---- fNOOOlf PP 0061-0074 CHEMICAL 6ETICS, PROBLEMS AND PROSPECTS 13 PP GUO JPR9 L/5803 SEMENOV'* NON, //GORE IYE I VZRYV// 00/00/1972/V---- N---- PP 0625-0633 THE ROLE OF NEGAIVE ATERACTION OF CHAlNS AND HETEROGENIC REACTIONS OF ACTIVE CENTERS DURING THE BURNING OF HYDROGEN 15 PP 000000049229 000000064852 000000016435 000000046225 000000007094 000000018764 000000043187 000000055666 000000002336 c, AIR /FTD-MT-24-1999 44 N SEMENOVI P. /)PLANOVOYE KHOZYAYSTVO// 00100/19761V ---- IN0001 NPP 0062-0070 PRODUCTION COMPLEXES I~ kAZAKHSTAN 12 PP 6 LIO JPRS L/6014 SEMENOV? R. N. /IMETEOROLOGIYA I GIDROLOGIYA// OO/11/1975,rV----..NOO11 PP 0109-0114 THE ACCUR-ACY OF MEASURiNG THE WIND VECTOR: ABOVE THE SEA BY. MEANS OF A DOPPLER NAVIGATION ~SYSTEM 11 PP 6U0 JPRS L/5591 SEMENOVP S. F. //VESTRIK AKADEMII MEDITkNSKIKH NAUK SSSR// 00/00/1975f V ---- ol N0009 p 0042-0047 THE ROLE OF IMMUNOSIOL66PIt-AL RESEARCH IN THE STUDY Of SYMPTOMATOLOGY PATHOGENESIS AND THERAPY OF SCHIZOPHRENIA lo PP JPRS 66414 SEMENOVP V. //ECON.-EKONOMICHESKIYE NAUKI// ---.00/00/1976PV---- NO008 PP 0045-0054 FINAMCIING, CREDI'GG i~STEMS EMPLOYED IN .AGRICULTURE 13 PP GUO JPRS L/'521 SEMENOVJF V. IKO IST// /19 O~/06/19 6,V ---- PNO009 PP 0119.-0122 "WO NWO 6 R APP ON THE SOVIE~ POLITICAL SYSTEM 5 PP R ~AP GUO __JPRS L/6 6 SE'MENOVO. //PLANOVOYE KHOZVAISTVO// OP105119 70, 'F N0005 PP 0097-016 E C6NOMI C ACCOUNTASILI~Y IN THE SOVKHOZES 9 PP GUO JPRS Lf? 33 SEMENOvf 11V. A. 11980ANIX TRUDOV VSESOYUZNOGO ZAOCHNOGO POLITEKANICHESKOGO INSTITUTA// ClO/OO/19711V----.N0O69., PP 0054-0062 ANALYSIS OF ACTION DURING SIMULTANEOUS DAMAGES Of PR07ECTIVE RELWYINGS AND SINGLE-PHASE AUTOMATIC RECLOSING5 (-SPAR) ~SESTASLI SHED ON, TWIN-CIRCUIT AWER TRANSMI ION LINES 11 PP AIR /FTD-MT-24-2631-74 SEMEWJVp V, A. //EMERGETIK/I 00/05/1976fV ---- ING005, PP 0011-0013 'CREATION Of AUTOMATED CONTROL SYSTEM AND USE OF COMPUTER TECHNOLOGY IN POWER SYSTEMS 15 PF GUO COPYRIGHT INFORMATION REFER OTHER REQUEST 10 FTD/STINFO -1 D(R S) T-0650-77 AIR/FlD 000000068546 000000033,573 000000027191 000000060201 000000059688 000000074659 000000006768 000000072318 SEMENOVO V. A. /tENERGETIK// 00105/1976 V---- N00051 PP 0011-0013 DEVELOPMEN~ OF ATOMATED CONTROL SYSTEMS FOR ELECTRICAL, POWER SYSTEMS DISCUSSED 7 PP Guo JPRS L/6628 SEMENOV V. G. //TRUDi KAZANSKOGO AVIATSIONNOGO INSTITUTA, NO. 167, GORENI-YE V -POTOKE, SBO.RNIK STATEY// 00/00/1974, V---- N0002 PP 0055,0065 STUDY OF LIMITS OF THE- STABILIZATION OF FLAME. WITH THE AID'OF THE CONTRARY SWIRL SPRAY OF TWO- PHASE COMBUSTIBLE MIXTURE 21 PP GUOitOPYRIGHT INFO REFER OTHERS TO FTD/STINFO FTD-ID(RS) T-0532-717 SEMENOV V G /lTRW KkAN'SKOGO AVIATSIONNOGO INSTITUTA KAZAN// 00/60/19?4.. V ---- IN01671 PP 0066-0076 STUDY OF THE MECHANISM OF THE STABILIZATION OF FLAME ON THE,CONTRARY SWIRL SPRAYS OF TWO-PHASE MIXTURE 20 PP GUO COPYRIGHT INFORMATION REFER OTHER REQUEST TO FTD/STINFO AIR /FTD-1 D(R S) T-0879 -77 SEMENOV V. 1. //ZERi6VOYE KHOZYAYSTVO// O0/12/1974fV----..N0012 PP 0027-0029 PROCEDURE FOR APPRAISI;G GRAIN QUALITY REVIEWED 5 PP JPRS 64022 V. N. //DEN'61 I KREDIT// 00/00/19751 V---- N0005 PP 0028-0037 CREDITS FOR SOVKAOZ CWITAL INVESTMENTS 12 PP JPRS 65449 SEMENOV V. N. //FIN;ASY SSSR// 00/04/1975,,V----,,N0O04 PP 0037-0043 DOUBLE PRICES ON AGRIC6LTURAL EQUIPMENT 12 PP JPRS 64726 SEMENOV V. N. //FINASY SSSR// 00/00119761V ---- IN0009 PP 0026-OOM ECONOMIC ACCOUNTABILI~ IMPROVED AT SOVKHOZES 15 PP GUO JPRS L/6570 ~SEMENOVt Vo P, //ZHURNAL ORGANIXHESKOI KHIMI111 00/00/1975 V0011 NOOOlt Pp 0218 PHOTOLYSIFOF TRfMETHYLAMMONIA P CHLORO -BENZA"IDATE TRIPLET P CHLOROBENZOYL NITRENE NTC 75 12149-07C SEMEMOV V. S. 11NAUdlWY KOMMUNIZM// 00/00/1975,,V---- N0003 PP 0098-0103 TRANSACTIONS OF 97H WALD SOCIOLOGY CONGRESS REPORTED 7 PP 000000067 080 00000.0070209 000000072277 000000004446 000000017157 000000008182 000000056378 000000037877 000000017051 JPRS 65436 SEMENOV V. S. //NAUiANYY KOMMUNIZM// 00/00/1976,V --- iaO003 PP 0021-0028 SOCIOECONOMIC D ELOPRNT OF THE SOVIET VILLAGE URGED 10 PP 6Uo JPRS L/6283 SEMENOV.# V. V. ./IDEN'GI I REDIT/I O0/0011976,V----,,N0005, PP 0010-0017 TASKS OF METALLURGICAL CHEMICAL INDUSTRIES DURING TENTH FIVE-YEAR PLAN 1b PP GUO JPRS L/6342 SEMENOV YE. //SOVE~SKAYA KUL'-TURA// 03/10/19751V----jN0080j PP 0003 WORK OF 13TH CONGRESS OF ALL-RUSSIAN THEATER SOCIETY DESCRIBED,, SECOND SESSION 5 PP JPRS 66113 SEMENOV, YE. K. //METEOROLOGIYA I GIDROLOGIYA// 00/00/1974,,V---- NOM PP 0051-0059 STRUCT(gE AND PdRATIO; OF THE EQUATORIAL ZONE OF WEST WINDS IN THE EASTERN HEMISPHERE 10 PP JPRS 63569 SEMENOV, YE. K. //METEOROLOGIYA I GIDROLOGIYA// 00/00/1975 V---- N0002 PP 0022-0029 SOME PECUIIARITItS Of iff INTRATROPICAL ZONE OF CONVERGENCE ACCORDING TO 06SERVATIONS FROM METEOROL06ICAL SATELLITES 10 PP JPRS 64670 SEMENOVf YU. /IMEZHOURMODNAYA ZHIZN' 00/00/1975,, V---- N0003 PP 0094-0104 SOVIET ATTACK CHINESE BATH TO SOCIALISM 15 PP JP&S 64569 SEMENOV, YU. N. //ELEC.-ELEXTRONNAYA OBRABOTKA MATERIALOV// O0)O0/19?lfV ---- INM Pp 0075-0078 METALL-CERAMIC MACHINNG ELECTRODE OF HIGH DURABILITY NTC 74-11899-13H SEMENOVA A. YE. //IZVEiTIYA TINRO// 00100/1974,vOO91 N---- PP 0031-0034 CONTENT OF NUCLEIC ACI'DS IN THE BODIES OF JUVENILE AUTUMN CHUN *NTIS IT 76-52009-E SEMENOVAf K. A. //PRIRODA// 00/00/1975,V---- N0001 PP 0000 FROM THE $TANDPOfNT OF'A PSYCHIATRIST 2 PP JPRS 64932 000000049213 000000059717 000000020073 000000003934 000000034742 000000037624 000000004597 000000044061 000000013208 SEMENOVA L M //DOKLAtY ~N 'SSSR BIOLOGICAL SCIENCES// 00/11/19761VO?31 Nb002 PP 0467-0470 MORPHO-ECOLOGIC4 CHAR'ACTERISTICS OF THE DIGESTIVE SYSTEM OF CLICK BEETLE LARVA (ELATERIDAEf COLEOPTERA) WITH VARIOUS KINDS OF NUTRITION 3 PP AVAIL LY SERIALS CONSULTANTS BUREAU SEMENOVA# LYUDMILA ANDREYEVNA //SOTSIOLOGICHESKIYE ISSLEDOVANIYA// 00/00/19751V ---- IN00021 PP 0186-0196 -APR-MAY-JUN 75 METHODOLOGICAL PRINCIPLES OF RESEARCH ON SOCIAL CONFLICT IN AMERICAN SOCIOLOGY 2 PP JPRS 66053 SEMENOVICH. N. 1. //KARDIOLOGIYA// OO/ll/l9?5fVOOl5fNOOlll PP 0023-0027 ALLER61C DISTURBANCES OF THE MYOCARDIUM DURING DRUG INTOLERANCE 12 PP 6UO PROPRIETARY (COPYRIGHT) INFORMATION OTHERS REFERRED TO FTD/STINFO AIR /FTD-IO(RS) 1-1354-76 $EMENOVICHf V. V. //SOVETSKAYA GEOLOGIYA// 00/00/1974 V--- ND007 PP 0003-0012 FURTHER D6ELOPANT OF'SCIENTIFIC RESEARCH IN THE FIELD OF GEOLOGY AND OF THE SURVEY AND EXPLORATION OF -PETROLEUM AND GAS 14 PP JPRS, 63414 SEMENTSOV, A. N. _7 //IZVESTIYA VUZ CHERNAYA METALLURGIYA// 00/0019761V---- N0005 PP 0064-0066 ON THE NON-UNIFO&ITY 6F HEAT EXTRACTION IN THICK WALLED MOULDS eISI 14651 SEMENTSOV, D. 1. //PHYSIC.-FIZIXA METALLOV I METALLOVEDENIYE// 00/09 /1975f VOO40f N---- PP 0656-0658 FERROMAGNETIC RESONANCE IN MULTILAYERED THIN FILM SYSTEMS GUO COPYRIGHT INFO REFER OTHERS TO FSTC ARM/FSTC-AST17DOI-011-77 $EMENYUK 6. M. /IZVESTIYA AKADEMIYA N H KH KH _NJK MOLDAVSKOI SSSR SERIYA BIOLOGICHESKIK I IMICHESKI NAUK// 00/00/19721V---- R0002 PP 0078-0080 VARIATIONS IN THE CONYENT OF NITROGEN PHOSPHORUS AND POTASSIUM IN THE LEAVES OF THE PLUM TREE ALONG THE_LENG7H OF THE BRANCH RTC 74-13407-02D SEMERCHAN/ A. A. oe/INZHEMERNO-FIZICHESKII ZHURNAL// 0/00/1960,.VW031NOO031 PP 0067 0090 ON THE THEORY OF DAMAGE BY CAVITATION NTC 74-11656-20K S.EMER I Af R. 000000072855 000000046525 000000066670 000000002732 000000041715 000000074018 000000012445 000000003965 000000025290 //PULVERIZATION OF A MELTED MATERIAL BY CONTACT WITH A REFRIGERENT LIQUID// 00/00/1968tv ---- lN--- PP 0001-0047 PULVERIZATION OF A ME~~EO MATERIAL BY CONTACT WITH A REFRIGERANT LIQUID *USEAC SAND 75-6003 SEMEYKOP L. S. //S$HA: EKONOMIKA, POLITIKA IDEOLOGIYA// 00/09 /1975, V---- N0009 PP OiA2-0055 TWO.POINTS OF VAW ON 'i]HE NONPROLIFERATION OF NUCLEAR WEAPONS 5 PP JPRS 65998 SEMIMNENKO, P. G. /IZERNOVOYE lQiOZYAYSTVO// 00/06/1976,V---- N0006 PP 0045-004? CONDITIONS FOR AHIEVIk HIGH QUALITY SUNFLOWER SEED PRODUCTION 9 PP GUO JPRS L/6270 SEMIKHNENKOO P. G. -j/SELEKTSIYA I SEMENOVODOSTVO// OO/0?/19?6lfV----,N0005, PP 0055-0057 SEP-OCT 76 SUNFLOWER SEED NUTRIENTS AND YIELD.6 PP GUO JPRS L/6784 SEMILETOV, S. A. I/METODY ISPYTANIYA KONTR. ISSLED. MASHINO STROM MATH.// 00/00/1971 V---- N0001 Pp 0100-0112 ELECTRON ~IFFROION 'f *NTIS TT 76-59209- SEMIN" S. //SOTSIALIST104ESKIY TRUD// 00/00/19741V ---- PNO012, PP 0012-0020 ORGANIZED COMPETITION AND WAGE CONDITIONS 11 PP JPRS 6426 SEMIN.. S. //VESTNIK STATISTIKI// 0010011976f V ---- f N0005f PP 0028-0031 EQUALIZATION Of ECONOMIC CONDITIONS OF REPRODUCTION ON KOLKJiOZES 5 PP GUO JPRS L/6183 SEMI Nt S. G. //ECON.-EKOHOMIKA I ORGANIZATSIYA PROMYSHLENNOGO PROIZVODSTVA// 00/G0/1976J*V--T-jN0004j PP 0092-0100 NEW RESERVES 0 HE SHCHEKINO METHOD REPORTED 9 PP GUO JFRS L/6559 SfMINARlOf WALTER //EQUI S-X // 01/06/1977 V---- N---- PP 0026-0028 LEFTIST SYUDENT 'EXPRESSES HIS VIEWS 7 PP JPAS 69397 SEMIOKMINAf A. F. //DOKLAUY AN SSSR,, BIOLOGICAL SCIENCES// 00/11/1976fV0231 N00021 PP 0503-0505 NEW DATA IN THE VUDY OF EXPERIMENTAL NEUROSES 000000018 207 000000059438 000000055042 000000056764 000000004941 000000059383 000000056299 000000075625 000000074242 ARISING DURING OVERSTRESS OF HIGHER NEURAL ACTIVITY 3 PP AVAIL LY SERIALS CONSULTANTS BUREAU SEMIRKHANOVAj. N. T. ~//LITEINOYE PROIZVODSTVO// 00/00/1970,,V---- N0006 PP 0036-0037 - 4 N ALUMINUM PHOSP14 ES A INDERS NTC 74-11814-13H SEMISALOVI YA. D. //KOKS I *iIMIYAi/ 00/00/1974,fV---- N0005 PP 0008-0009 ' O -CHEMICAL COMPO F COAL-ASH. ION O NTC 75-12702-210 SEMKOp M. F. ItDOKLADY AKADEMII NAUK SSSR// PP 1303-1305 ELECTRON MICROSCOPE IN~ESTIGATION OF THE WEAlt OF INDIVIDUAL DIAMOND GRAINS AIP SEMKOVSKIY1 V. V. //BUL.-BYULLETEN' STROITEL'NOY TEKHNIKI 00/0011976fV---- NOG03 PP 0017-0021 ' i PLAN FOR MECHANI ATION OF CONSTRUCTION DESCRIB ED 7 PP 6uo JFRS L/6168 sit P //ZWR // -0257 00/00/1974,V0063 N0006 PP 0255 THE TONGUE AND ATERNZ DISEASES 11 PP UNCLASSIFIED (COPYRIGHTED) NNMC TRANSLATION NO. 1786 SEMLERI P. //ZWR// 00/00/1974.,VO083 N0006 Pf 0255-0257 A K THE TONGUE AND I TERN DISEASES 11 PP UNCLASSIFIED (COPYRIGHTED) NNMC TRANSLATION NO. 1786 SE"OVI V. //TRUDY NAUCHNOIZSLED. INST. VODOSNABDYAVANEI KANALIZ. SANIT. TEKH// 00100119721V0008,0001 , PP 0183-0190 . MICROBIAL DEGRADATION OF PHENOLS IN THE PURIFICATION Of PHENOLIC WASTE WATERS WITH ACTIVATED SLUDGE 7 PP ERDA ORNL TA-2983 SEMPOLOWSKI A -/IBEITRAEG~ ZUR KENNTNISS DES BAUES DER SAMEN SCHALE// 00/00/1874,V ---- tN----, PP 0068 THE SEED COAT *NTIS TT SEMPRUN ALFREDO 7 IIAOC 1 2 0102 /19 7 5, V ---- IN ---- I PP 0031-0032 SINI-$TER MAN DIRECTIN6 ATTACKS 5 PP . JPRS 64402 000000004596 000000046092 000000031916 000000051339 000000018993 000000019502 000000027117 000000071166 000000011533 V. M. //AVTOMATICHESKAYA SVARKAI/ 00/00/1973,. V ---- IN0010I PP 0052-0054 DEFORMATION IN ELECTROSLAG WELDING OF ALLOY STEELS -OISI 12686 SEN GUPTk A. K. I/FETTE SEIFEN ANSTRICHMITTEL// 00/00/1976,,V0078 N0002 PP 0059-0061 CHANGES IN THE LfPIDS "F SOYBEANS DURING 0 STORAGE AND GERMINATION *NTIS'TT 77-59121 SEN,? WHIT //KOMMUNIST// 00/12/1975f V---- N0018 PP 0106-0112 NAOISM--EVOLUTIA TO TAE RIGHT 9 PP JPRS 66651 SENBERGER.. J. //SLEVARENSTVI 00/00/ 19 75f V N ---- f PP 0097-0100 TECHNICAL AND ECONOMIC QUESTIONS OF STEEL MAKING IN THE ELECTRIC ARC FURNACE AND IN MEDIUM FREQUENCY INDUCTION FURNACES _BISI 13797 . i SENBERGER,. J. //SLEVARENTSTVIX// 00/00/1975 V---- N---- PP 0097-0100 TECHNICAL ~iD EC6NOM16L PROBLEMS OF'STEEL MAKING IN ELECTRIC ARE FURNACES AND IN MEDIUM FROUENCY INDUCTION *BISI 13797 SENBERGER, J. //SLEVARENSTVI// 00/--/1976,,V0024 N0007 PP 0269-0272 THE MAKIN6 OF RAMED LININGS IN MEDIUM FREQUENCY FURNACES USING DRY RAMMING MATERIAL AND RAMKING, MATERIAL AND REMOVABLE FORM *8151 15195 SENBERGER, J. //SLEVARENSTVI// OMO/1976fV0024 N0007 PP 0269-0272 THE MAKING OF RAMED LINING IN MEDIUM- FREQUENCY FURNACES USING DRY RAMMING MATERIAL AND REMOVABLE FORM BISI 15195 SENCHAGOV V I/PLAMOVOYE'KNOZYAYSTVO// 00100119?5fV---- NOM PP 0082-0090 FINANCIAL METHOA FOR 'STIMULATING CAPITAL INVESTMENTS 14 PP JPRS 65656 SENCHEMKOf V. //PRAVDA UKRAINY// 18 /02/1976,, V ---- 1,14-- PP 0002-0003 TENTH FIVE-YEAR PLm,, hOBLEMS OF ADMINISTRATION 10 PP JPRS 67295 000000003133 000000070718 000000033958 000000036101 000000040589 000000063697 0G0000068815 000000022540 000000068438 SENCHYUKo G. V. /I TOVAROVEDENI E 00/00/1974 V---- N0007 PP 0044-0045 ANTIMICROBiAL PR6PERTAS OF CRANBERRY JUICE NTC 76-13308-06H SENCZUK, W. //PRACE POZNANSKIE TOWARZYSTWO PRZYJACIOL NAUK KOMISIJA FARMACEUTYCZNA// 00100094.30011 N----t Pp 000?-0020 INVESTIGATIONS Of THE UNG SILICON EXCRETION PROCESS AND THE GRINDING DUST BIOLOGICAC ACTIVITY NTC 76-13416-061 SENDUNGER G. //VERPAC6NGS RUNDSOAU// 00100/1973, V00241 N ---- If PP 1437 MORE 370M1 EURO-GLASS CONTAINERS FOR PREPARED POTATOES PIRA-10M SENFr H. //WORKING GROUP FOR BALLISTIC RESEARCHI WEIL AM RHEIN// 00/--/---- V---- N----, STUDY OF 'AE TERMINAL BALLISTIC EFFECT OF MODEL FRAGMENTS OF VARIOUS CONFIGURATIONS AND STRENGTH *FSTC-IMIS 11601-051-76 -SENFf H. //DETERMINATION OF SECONDARY EFFECT PATTERNS OF INFANTRY AMMUNITION AGAINST HARD TARGETS// 00/10/1975 V ---- IN ---- I 13-15 OCT ~5 DETER14INATION OF SECONDARY EFFECT PATTERNS OF INFANTRY AHMUNITION AGAINST HARD TARGETS. MEETING AT MBS SCHROSENHAVSEN .*FSTC-IMIS 11601-047-76 SENF, WERNER //BAUPLAMUNG-BAUTECHNIK/I 00/0Z/1976 V---- NOOOZ PP 0072-0076 EXPLOSION kOTE610N RiGULATIONS OUTLINED 11 PP JPRS 67030 7. SENGHORI L. S. //JEUNE AFRIQUE// 07101/1977/V ---- IN---- PP 0037-0044 PRESIDENT SENGHOR SURVEYS AFRICAN SITUATION, OWN FUTURE 15 PP Guo JPRS L/6865 SENGHORI L. S. //JEUNE AFRIQUE// 07/01/1977d-~iN --- ~ PP 0037-0044 PRESIDENT SENGH SUR EYS AFRICAN SITUATIONf OWN FUTURE 15 PP JPRS L/6865 SENILOVI G N //SVETOTE6NiKA// OO/Ofi/19661VO012 H0001 PP 0023-0026 THE SIM-1 (SIM-2f AIR~AFT PULSE BEACON NTC 74 12941-DIC 000000073142 000000073283 000000048198 000000063754 000000063746 000000026214 000000063267 000000063376 000000016302 SENIN, N. 6. 000000002703 //PROBLEMY DAL'NEGO VOSTOKA// 00/00/1974,V----,NO003 PP 0155-0167 SUBJECTIVE SOCIOLOGY--~HE IDEOLOGICAL FOUNDATION OF MAOISM 1 P JPRS 63409 ---SENIN.. N. G. //PROBLEMY DAL' NEGO VOSTOKA// 00/00/1975,,V --- ? N00031 PP 0126-0137 SOPHISTRY IN TH GUISE OF DIALECTICS 14 PP JPRS 66366 SENINA,p M. V. //SSHA: EKONOMIKA POLITIKAt IDEOLOGIYA// 00107/1975 V----..NO007 PP 0122-0127 THE EVOLUTION OF AMERItAN-CHINESE ECONOMIC RELATIONS 9 PP JPRS 65458 SENINAp Z. I/MUKOMOL-NO-ELEVAT KOMBIKORMOVAYA PROM// 00/00/1973rVW N ---- ~IPP 0017:0018 ACCELERATED METH60 OF TAMIN 8 1 ANS 8-2 'DETERMINATION IN PREMIXES 2 PP *NTIS TT 75-55006 SENKEVICH.0 T. G. //DOKLADY AKADEMIl NAUK SSSR// 00/03/1974pVO215 N0003 PP 0733-0736 OLIGOMERS OFTHE kEPLICATIVE FORM OF ENCEPHALOMYOCARDITIS VIRUS RNA CB SENKEVICHf T. P. //6IDROTEKHNIKA I MELIORATSIYA// 00/08/1974d---~N0008f PP 0001-OM RURAL LAND DEVE OPMENT DISCUSSED 7 PP JPRS 65093 SENNI J. //IEITSCHRIFT FUER TIERZUECHTUNG UND ZUECHTUNGSBIOLOGIE// 00/00/19730,VO0891ND004, PP 0312-0322 THE KOREAN CATTL *NTIS TT 76-53307 SENNA, M. //JOURNAL JAPAN SOCIETY OF POWDER AND POWDER METALLURGY// 00/00/1969 V0015 N---- PP OMl-0386 THE EfFECYOF PWTICLE'DIAMETER RATION ON THE FRICTION AND COHESION OF POWDER MIXTURE *XTIS TT 76-53645 SENKIKOV G N. //VESTNIK 4ADEMII MEDITSINSKIKH NAUK SSSR// 00/00/1975,,V ---- ING003t PP 0090-0092 PROBLEMS DEALING WITH THE ACTIVITIES OF SCIENTISTS AND SCIENTIFIC TEAMS 6 PP JPRS 64795 CIENTURKf NAMIK K. //MILLIYET// 27/01/1975 V---- N---- PP 0009 POLICE MEWSURE I's NOT 'ENOU(,H 10 PREVENT STUDENT CLASHES 8 PP JPRS 64148. 000000037916 000000030494 000000011818 000000006270 000000029660 000000044962 000000049014 000000008216 000000004814 SENTYAKOVO N. M. /IDEN'61 I KREDIT// 00100/1975 V---- N0009 PP 0011-0018 BETTER ECO;OMIC 'DATA S~STEM PROPOSEDTOR BANK 10 pp JPRS 66381 SENUXO, V. M. //TRUDY INSTITUTA GORNOGO DELA// 00/00/1972,V---- N0036 PP 0085-0090 DETERMINING THE AAXIMUM D.ISTANCE BETWEEN SIMULTANEOUSLY EXPLODING, EXPLOSIVE LINE CHARGES WHICH PROVIDES A BREAK IN THE CONTINUITY OF A SOLID MEDIUM AIR /FTD-ID(RS) 1-0131-76 SEOLDNERI F. t/MAX-PLANCK INSTITUT FUER PLASMAPHYSIKI/ 00/00/1974 V ---- *N----,, REPORT IPPtl/141' INVESTIGATION OF FAST MAGNETIC PLASMA COMPRESSION AS METHOD FOR GENERATING HIGH TEMPERATURES WITH WEAK COMPRESSION AEC-LA-TR-74-32 NTC 7-4--13526-201 SEPPALA,, RAIMO //SUOMEN KUVALEHTI// 23/05/1975FV--;~NO021, PP 0032-0037 ARVO HAUTALA R CTS TO STALINIST, SOVIET CRITICISM 7 pp JPRS 65180 SEPPALAf RAIMO //SUOMEN KUVALEHTI// _301/05 /19 7 5f V ---- fN0022 PP 0045-0047 - TIGHTER CONTROL OF INDOSTRY SOUGHT 7 PP JPRS 65455 SF-PPALAO, RAIMO //SOUMEN KUVALEHYI// 15/08/1975 V"!--- N00331 PP 0024-0027 BANK Of 6LAND PRESID NT ON ECONOMIC PROBLEMS 7 P JPRS 65815 SEPPALA,, RAIMO /ISUOMEN KUVALEHTI// 05/09/1975fV ---- IN0036 PP 0038-0041 FINNISH EDITOR VISITS 6WEGIAN-SOVIET BORDER, NORWAYf NATO AND THE CLOSED BORDER 7 Pp JPRS 66037 SEPPI, 1. V. //PRAVDA// OO1OO11972fV----,,NoOO8" PP 0016 80TULISM *FSTC-HT-23-0711-75 ---SEQUIN H //ANWALS:-ANNALES DES TELECOMMUNICATIONS// 00/00/1974,,V0029 N----' PP 0271-0280 THE CORRELATION 6ETWEEh SUCCESSIVE ANIMATED -IKAGES AND TIKE CODIW) NTC 76-10010-170 000000037980 000000037811 000000026229 000000031120 000000014204 - 000000021452 000000025921 000000011333 000000067211 SERA,, K. 000000035242 //JAPANESE JOURNAL OF THORACIC DISEASE// 00100/1972 1V---- N0010 PP 0069 METHOLOGICAL CHAGES I& SCLERODEMA ER DA-Lf -TR -107 SER Ao K. //NIHON KYOBU SHIKKAN GAKKAI ZASSHI// 00/00119721V0010 N---- PP 0069 PATHOLOGICA~ CHAGES I; SCLERODERMA 3 PP ER OA-LF -TR -107 SERAFIMOVf KIRIL //VECHERNI NOVINI// 05 109 /19 7 5f V---- N---- PP 0006 -SCIENTIFIC.ACHI6EMENT' OUTLINED 5 PP JPRS 65882 SERAFIMOV KIRIL S. //SPISANIE NA BULGARSKATA AKADEMIYA NA NAUKITE// 00/G0/19?6#lV---;tN0&P`P 0054-0062 DEVELOPMENT OF IENTI C INSTRUMENTS DISCUSSED 10 P? AS 6895Z N SERAFIN, GOERGE //LUMEA// 28/0811975 V---- N---- PP 0006-00 -07 I ON AM6 BAWN STATES URGED BY 'LUMEA' COLLABORATI NG 5 PP JPRS 65740 SERAPHIN, L. //REVUE.-REVUE DE METALLURGIE// OD1.00/197400071,N0001, Pp 0019-0036 HEAT RESISIANT T TANIUM ALLOYS, INTRODUCTION OF THE ALLOY UT 651A NTC 76-10219-11F SERBAN, D. //REVUE. -REVISTA DE IGIENA,. BACTERIOLOGIEf VIRUSOLOGIE,, PARAZITOLOGIE, EPIDEMIOLOGIE,, PNEUMOFTIZIOLOGIE--IGIENA// 00/01119751V ---- 00001f PP 0019-0023 JAN-MAR 75 USE Of PHOTODOSIMETRY IN CASE OF NUCLEAR ACCIDENTS 6 PP JPRS 64990 SERBAN, GH. //REVUE. -REVISTA ECONOMICA// 11/02/1977 V---- N0006f PP 0001-0002 ACHIEVEMEN~S OF **1976 REVIEWED 6 PP JPRS 68947 SEROAMESCUI A. //KlCftOCH MICA ACTA// 00f00/1970jV----roN---~j PP 0928-0932 --"tAROGRAPHIC AND SPE ROPHOTOMETRIC STUDIES OF THE MICROQUANTITIES OF METALS AND PORPHYRINS IN PETROLEUMS AND THEIR DERIVATIVES 10 PP GUO NASA TT F 16290 SERSAMESCU, A. //MIKROCHIKICA ACTA// 0010011970fv ---- fN---- PP 0928-0932 POLAROGRAPHIC AND SPECiROPHOTOMETRIC STUDIES Of THE MICROQUANTITIES Of METALS AND 9 000000050976 000000029058 000000062344 000000021132 000000067599 000000010058 000000062308 000000048835 000000044910 P.ORPHYRINS IN PETROLEUMS AND THEIR DERIVATIVES NASA-TT-F-16290 SERBANESCU A. //MI KRO CHI MICA ACTAII 00/00/1970 V---- N --- ~~OPP 0928-0932 f POLAR06RAPAIC AND SPE PHOTOMETRIC STUDIES OF THE MICROQUANTITIES OF METALS AND PORPHYRINS IN PETROLEUMS AND THEIR DERIVATIVES. NTC 75-12709-21D SERBANISCU A. //MlKROCHfMICA ACTA// Cl0/00/197ClfV----fN ---- f PP 0928-0932 NO ENGLISH GIVEN *NASA TT F-16290 SERBAXESCU.. ILIE 12/06/1975 V---- N----, PP 0018-0019 19 JUN 75 P*P 20421 NEW TYPE OF ECONOMIC RELATIONS AMONG SOCIALIST COUNTRIES DISCUSSED 15 PP JPRS 65246 SERBRYAKOVP I. V. //TSEMENT// 00/00/1972 V---- N0001 PP 0011 FAST SELEC~ION Of THE AAKE-UP OF THE BALL- CHARGE OF MILLS NTC 74-12422-118 SERD,.ININI I* me /ISSNA: EKONOMIKA, POLITIKA, IDEOLOGIYA// 00/10/1976 V---- N0010 PP 0%6-M7 W BOOK A60 TAE UN ~ PP E N 6UO- JPRS L/6629 SEROYUCHEN% D. P. //DOKLAOY SSSRr EARTH SCIENCE// 00/00/1974 V0218,,NOMI PP 1175-1177 SEPT-OCT 1674 METASEDIMENTARY MONAZITE IN RIPHEAN SCHISTSOF TI MANS AMERICAN GEOLOGICAL INSTITUTE SERDYUK, A. M. //GIGIYENA NASELENNYKH MEST// 00/00/1975 V ---- fNO0141 PP 0095-0099 STATE OF iAE CARDIOVASCULAR SYSTEM UNDER THE CHRONIC EFFECT Of LOW-INTENSITY ELECTROMAGNETI FIELDS 5 FP GUO AS L/5615 SEROYUKf D. S. //SOVETSKOYE ZORAVOOYHRANENIYE// 00/00/1975fV----..N0009j PP 0049-0053 FIRST AID IN AREAS CONTAMINATED WITH EXTREMELY TOXIC POI".S,5 PP JPR S 66069 SERDYIJKf V. V. l/DOKLADY AN SSSR// 00100/19751VOWIN0004, PP 0904-0905 000000046091 000000028914 000000017263 000000005602 000000065721 OOOOOn2696 000000022113 000000046585 000000028088 4 PROCESS RATES FOR THE DECOMPOSITION OF SUBSTANCES IN ELECTROLYTE SOLUTIONS c8 SERDYUKOV V. M. //PHOTOGAAMMETRY IN CONSTRUCTION ENGINEERING// ---00 / 00/ 19 7 01 V ---- It N ---- I PP 0000 PKOTOGRAMMETRY IN CONSTRUCTION ENGINEERING 182 Pp ARM/FSTC-HT-23-715-73 SEREBRENIKOVF V. S. //RADIOBIOLOGIYA/I O0/0O/19?4..VOO14fNOOO3j PP 0450-0453 ACTIVITY OF THE INCORP,ORATIQN'OF RADIACTIVE -------fHOSPHATE IN 6AtMMA AND ELECTRON IRRADIATION Of POTATO TUBERS AEC-TR--7596, PP 176-180 SEREBRENIKOV, V. S. f /R ADI OBI OLOGI Y A/ / . 00/00/1976,fV0016 N0003 -PP 0469-0471 LOCALIZED CHANGE~ IN EIECTRON IRRADIATED POTATO TUBER S ERDA-TR-222, PP 185-188 SEREBRIISKIY YA. 14. //TRUDY TSE4TRAL'NOGO AERO-GIDRODINAMICHESKOGO INSTITUTA IM N. YE. SHUKOVSKOGO/I 00/00/1939 V----,,NO422 PP 0001-0012 EXPERIMENYAL STUDY OF VERTICAL APPROACH OF A FLAT PLATE IND INCLINED APPROACH OF A WING TO THE GROUND NAV NISC TR-3748-76 SEREBRIITSKIY YA. N," //TRUDY TSEN'WL'NR0 AERO GI DRODINAMI CHESKOGO INSI TUTA IM N. YE. ZHUKOVSKOGO// 00/0011939 V-- N0422 PP 0001-0012 EXPERIMERYAL S~~'DY OF VERTICAL APPROACH OF A FLAT PLATE AND INCLINED APPROACH OF A WING NISC 3748 SEREBRIYSKIY YA. M. //TRUDY TSE;TRAL'ROGO AERO-GIDRODINAMICHESKOGO INSTITUTA IM. PROF. N.E. ZHUKOVSKOGO// -00/00/1936,,V ---- fN ---- f PP 0001-0037 THE GROUND EFFECT ON THE AERODYNAMIC CHARACTERISTICS OF AN AIRCRAFT 53 PP NAV/NI SC-TR-3700-75 SEREBRIYSKIY, YA. M. //TRUDY TSENTRAL'NOGO AERO-610RODINAMICHESKOGO INSTITUTA IM PROF N.- E, ZHUKOVSKOGO VYPUSK// 00/00/1936,V0267 N---- Pp 0002-0037 THE GROUND EFFEC~ ON TAE,AERODYNAMIC CHARACTERISTICS OF AN AIRCRAFT NISC 3700 SEREBRIYSKIY YA. M. //UCffENYYE fAPISNI TSAGIII 00/00/1970,0001,0005, PP 0023-0028 APPROXIMATION METHOD 0 THE EVALUATION OF THE OPTIMUM POS17ION OF MECHANIZATION ON SHAPE ZO PP AIR/FTD-MT-24-356-75 SEREBROVs A. 1. //VOPRO Y ONKOLOGII// WOO/1975f voozif MOODS PP 0003-0013 ONE Of THE POSSIBLE 014ECTIONS~OF RESEARCH 000000007454 000000016430 000000072389 000000045649 000000035296 000000018382 000000029461 000000045143 000000065581 IN ONCOLOGY NTC 76-10147-06E SEREBROVA,, A. //GUDOK// -7- 19 /09 /1976, V---- N---- PP 0003 ~i 6 REPORT ON GRAIN ANSP RTAITON PROVIDED, CONCERN FOR GRAIN EXPRESSED 3 PP JPRS 68105 SEREORYAKOV,, A. A. I/MGI // 00/00/19761 V---- N0002f PP 0024-0036 TRAVELLING OF LOk WAVES WITH REGARD FOR DISPERSION AND NONLINEARITY IN A BASIN OF VARIABLE DEPTH *FEDERAL RESEARCH DIVISION L OF C SEREBRYAKOVf A. V. IISSHA: EKONOM~~A, POLITIKA IDEOLOGIYA// 6 00/10/1976, V---- N0010 PP 0 8-0049 ' PROBLEMS OF PROFiSSION AL SPORTS 2 PP GUO JPRS L/6629 SEREBRYAKOV, 8. R. //DOKLADY AKADEKII NAUK SSSR// 00/02/19741V0214IN00041 PP 0872-0874 CONCERNING THE HETEROGENEOUSLY CATALYZED VAPOR-PHASE OXIDATON OF PROPYLENE TO PROPYLENE OXIDE ce SEREBRYAKOV G. //KOMMUNI~T VOORUZHENNYKH SIL// 00/02/1976,V---- NM PP 0073-0077 ' THEORjETICAL CON4RENCE FOR OFFICERS IN THE GSFG 7 PP GUO JPRS L/5936 SEREORYAKOV M. YE. ' i4 //VMULREN AYA BALLISTIKA STVOL NYKH SISTEM I P ORSKHOVYKH RAKET MOSCOW 00/00/1962f V---- m---- PP 0249-0259 " ' IN iS OF TERIOR BALLIS7I BORE SYSTEMS AND SOLID FUEL ROCKETT ALSO PP 305-310 FSTC-HT-23-2170-72 SEREDRYAKOV, 0. 1. //GEOLOGIYA NEFTI I GAZA// 00/00/1975,f V ---- IN0002 PP 0055-0059 --.-.--41GI41FICANCE OF BENZOL IN FORMATION WATER$ IN OIL--GAS EXPLORATION PETROLEUM GEOLOGY VOL 13, NO 2f 1976 SEREORYAKOVf Of 1# //GEOLOGIYA NEFTI I GAZA// 00/00/1975,V---- M0004 PP 0031-0034 W R DISTRIBUTION OF HT NE ACIDS IN OILS OF THE CASPIAN RE61ON VOL 13, NO 4 PETROLEUM GEOLOGY SEREORYAKOVA/ Z, N, 11SPRAVOCHNIK PO PSIKHIATRII// 00/00/1974,V----,N----, PP 0000 000000056648 000000070606 000000065727 000000003687 000000,035411 000000031388 000000061192 000000061382 000000020011 ORGANIZATION OF PSYCHIATRIC CARE 5 PP JpRS 66097 SEREBRYANIK, G. 1. //STAL// 00/00/1974 V---- NO0021 Pp 0109-0110 VARIATION IN THE'SIZE GRADING OF THE MIX DURING -SINTERfNG BISI 12330 SEREORYANYYI M. 1* //DEN'GI I KREDIT// 00/03/1976tV ---- IN0003 PP 0090-0094 ORGANIZATION AND PLANilNG OF CREDIT 10 PP GUO JPRS L/6001 SEREDA, 6. K. IIINZHENERNAYA PSIKHOLOGIYA// 00/00/1976,V ---- IN---- EN61NEERING PSYCHOLOGY 307 PP *ACSI K-6709 SEREDAi YU. S. //DOKLADY AKADEMII NAUK SSSR// 00/02/1974 V0214 M0006 PP 1358-1360 QUANTITATI~E EMMATIA OF PACKING IRREGULARITIES IN AMORPHOUS ~,,,OLYMERS c8, SEREDIN, YU. V. //VODOZNABZHENITE I SANITARNAYA TEKHNIKA// 00/00/1965 V0006 NM, PP 0016-0017 VENTILATIOh CONDFIONS FOR EXHAUST HOODS WHEN WORKING WITH RADIOACTIVE SUBSTANCES 6 PP JPRS 67590 SEREGIN, A. //KOMMUNIST VOORUZHENNYKH SIL// 00/05 /19771 V---- N00091 PP 0072-0080 INSTRUCTOR OUTLAE FOR INDOCTRINATION ONJOREIGN. INTERVENTION, CIVIL WAR 13 PP JPRS L/7220 SER-EGIN.. N. S. //SSHA: EKONOKIKA, POLITIKA IDEOLOGIYA// 00/01/1976,PV ---- lomooolf PP 684-0087 DEBATE ON BIGGER MILITARY SPENDING 6 PP GUO JPRS L/5623 SEREGINt N. S. //SSfiA: EKONOMIKA POLITIKA IDEOLOGIYA// 0O/03/1976jV----"NKO3f PP 94-0098 ELECTION CA14PAIGN ACT; A BALANCE SHEET 2 PP Guo JPRS L/5849 SEREOINf V. V. //IZVESTIYA VUZ PRIBOROSTROYENIYE// 00/00/1975,V ---- INO012f PP 0055-0058 SPEED Of A GYROOPTICAL COMPAS 4 PP 6uo JpRS L/5885 000000000397 000000049088 000000060672 000000003,670 000000051965 00000007 2948 000000022410 000000068603 000000068 119 SEREGIN, V. V //PRIBOROSTR;YENIYE// 00/00/1976 V0019 NOW, PP 0093-0084 OF GYROC6MPASS VIBRATIONS.3 PP 6UO, JPRS L/6187 SEREGINA,, V. A. l/DOKLADY AN SSSRr PHYSICAL CHEMISTRY// 00/0111976010226fNO003f PP 0640-0642 EXTENDED HUCKEL MOLECULAR ORBITAL CACLUATIONS ON HYDROXYLATED ZEOLITE FRAMEWORK STRUCTURES CB SERENIj, JEAN PIERRE t/JEUNE AFRIQUE// 02/07/1976 V---- N---- PP 0037-0039 REGIME ALWMS NEIGH804,. ARABS, WESTERN POWERS 5 PP GUO JPRS L/6246 SERENIp JEAN-PIERRE /IJEUNE AFRIQUE// 3'1/03/1973,V ---- fN ---- f THE SAFE OF OPEC PP CSO: 8119/0477 COMPLETED SPECIAL S ER EN KO A. F. //TERWEVTICHESYJI ARKHIV// 00/00/1974fVD046 N0006 PP 0003-0009 PREVENTION -- THi BASI~ OF SOCIALIST PUBLIC HEALTH NTC 75-12756-06E .-SEREMKO, A. F. /tHEDICINA// 00/00/1975f N----, PUBLIC HEALTH IN THE SOCIALIST SOCIETY 286 PP ~ACSI K-7085 SERENSENt S. V. //KONSTRUKTSIONNAYA PROCHNOST' AVIATSIONNYKH SPLAVOV// 00/00/19621V---- N ---- I PP 0003 ALSO PP 38 -4 01 1 . 1 CONSTRUCTION STRENGTH OF AVIATION ALLOYS 25 PP *FTD-I.D(RS)T-0284-76 SERESS 1. //CEAOSLOVENSKA HYGIENA// 00/05/1965,VG0101N ---- I PP 0081-0085 ABATEMENT N THE ZETOR-SURER TRACTOR PROTOTYPE 9 PP ARM/FSTC-1350-75 SERGEEV., G. 8. ... . ....... //DOKLADY AN-SSSR, PHYSICAL CHEMISTRY// 0/05/1974fV0216 N0003 PP 0595-0598 ACTIVATION OF lHi PEOIDASE-CATALYZED OXIDATION OF QUINOL PHOSPHATES BY SUBSTRATES ce SERGEEVA, T. K. /IPHYSIC.-FIZIKA KHIMIYA MEKHANIKA MATERIALOV// 00/00/1974,vooio Noooll PP 0091-0092 CRITICAL COEFFICf ENT OF STRESS CORROSION CRACKING OF HIGH-STRENGTH STEEL 000000059391 000000062169 000000057365 000000034421 000000053818 00000G069 06 6 OD0000024912 000000061262 000000011758 000000001920 HB 9359 SER6EEVAj V. N. //CHEM. KHIMIYA DREVESINY// 0010011973, V ---- PNO013 PP 0077-0084 THE BEHAVIOUR OF LIGO WHEN WOOD IS TREATED WITH AMMONIA NTC ?5-13242-IIL SERGENT M. //COMP~ES RENDUSP ACADEMIE DES SCIENCES1 SERIE C// 00/00/1972,0274,0024, PP 1965-1967 ENGLISH TITLE UN OWN *NASA TT F 17365 "´┐ŻERGENTO, M. //COMPTES RENDUS ACADEMIE DES SCIENCE SERIES C// 00/00/1972 V0274 N0024 PP 1965-1967 -M SUB XMOKE4 (4ETAa PHASES ASSUMING MOLYBDENUM SELENIDE M03SE4 AS THE HOST STRUCTURE 8 pp ASA TT F 17365 S66ENT, M. -//JOURNAL OF SOLID STATE CHEMISTRY// 00/00/197310006100031 PP 0433-0437 NEW TERNARY-PHASE MOLYBDENUM SELENIDES NASA TT F 17319 SERGENT PIERRE ME FfGARO// 14/11/1975,,V---- ---- Pp 0008 i;)VEM' ARMY TRADE UNION ENT ASSAYED DEPLORED, DRAFTEES' UNION SEEN AS LEFTIST-IhSPIRED 3 PP JPRS 66433 SERGEYE, M. //PHYSIC. -FIZIKA TVERDOGO TELA// 00/00/19741fv---- N---- STUDY OF THE MOING 4 SIMPLE SUBSTANCES UNDER HIGH PRESSURES -10993-75 ERDA UCRL TR SERGEYEV //MORSKOY SBORNiK// 00/07/1975,,V ---- ** ENGLISH TITLE UNKNOWN 8 pp DIA LN 106-76 SERGEYEVI A. //TEC".-TEKHNIKA I NAUKA// 00/10/1973 V---- N0010 PP 0004-0006 HOW TO LOWii THE'COST 'OF AUTOMATED CONTROL SYSTEMS 11 PP GUO COPYRIGHT MATERIAL OTHERS CONTACT FTO AIR /FTD-fiT-23-789-75 SERGEYEV,, A. A. //OTECHESTVENNAYA LITERATURA PO AVIATSIONNOY KOSMICHESKOV I VYSOKORGORNOY 6IOLOGIl I MEDITSINE/ 00/0011974f V-;~aN ---- ~ PP 0000 RUSSIAN LITER E ON VIATION SPACE AND HIGH ALTITUDE BIOLOGY AND MEDICINE NTIS TT 75 52043 SER6EYEV, A. D. //DOKLADY AKADEMII NAUK SSSR MINERALOGY// -1402 00100/1973fVO213fNO0061 PP 1399 000000062117 000000067828 000000074050 000000074051 000000037972 000000054174 000000027137 000000016665 000000005577 000000005650 I BROMELLITE FIND IN METASOMATIC ROCKS OF A TIN DEPOSIT IN TRANSBAIKAL AMERICAN GEOLOGICAL INSTITUTE SERGEYEV A. N. /lPRIB0hSTROYENIYE// 00/00/1974p V---- N0006 PP 0068-007~ NAV16ATION SYSTEA IN ih SINGLE STAR ASTROCOORECTION MODE JPRS 63339 SERGEYEV, A. V. //ZDRAVOOKHRANENIYE ROSSIYSXOY FEDERATSII// OO/0O/19?6..V---;tN0OO2 PP 0003-0008 DEVELOPMENT OF BLIC AEALTH IN RSFSR IN NINTH FIVE-YEAR PLAN 8 PP 6U0 JPRS L/5924 SERGEYEVI F. /lIMPERIYA V IMPERII// 00/00/1972?V----,N---- EMPIRE WITHIN EMPIRE, ~56 PP CSO: 8344/0833 COMPLETE $PECIAL SERGEYEV, F. //OCLAE// 00/00/1974,V---- N0005 PP 00Z8-0043 WITHOUT LEAVING iHE OFfICE: THE SECRETS OF THE SECRET SERVICES 19 PP Guo JPRS L/5186 SERGEYEVI F. //OCLAE// 00/00/1975, V ---- IN0003 PP 0026-0039 U S. MILITARY, ECONOWC INTELLIGENCE COLLECTION A~SESSED 14 Pp GUO JPRS L/5377 SERGEYEVI 6. a. //PROBLEMY KINETIKI I KATALIZA// 00/00/1973"1 ---- IN ---- I PP 0220-0232 HALOGENATION. AND HYDROHALOGENATION OF OLEFINS IN SOLID PHASE 29 PP AIR/FTO-MT-24-1772-74 SER6EYEV G. 8. //DOKL;(DY AKADEMII NAUK SSSR// 00/02/1974,V0214 N0006 PP 1354-1357 KINE71CS Of ENZYkC OHDATION IN FROZEN --Ar)UEOUS SOLUTIONS Co SERGEYEVI Go 8. //DOKLAOT AN SSSR PHYSICAL CHEMISTRY// 0010011975,0221,0002t PP 0384-0387 MICELLAR CATALYSIS IN FROZEN SOLUTIONS SERGEYEV/ 6. 0. //DOKLADY AN $SSR4 PHYSICAL CHEMISTRY// 00/09/1975 vC1224,0002, PP 0387-ONO EFFECT OF ~EMPERATLJRE ON EXPERIMENTAL ACTIVATION ENERGIES N 000000004273 000000040427 000000028969 000000003391 000000025470 0000000036C9 000000003669 000000044681 000000049442 SERGEYEV G. YA. //KERNEkNERGI E // 00/00/19590, V0002rN ---- p pp 0935-0939 NO 10-li MECHANICAL PROPERTIES OF URANIUM. 14PP SANO-76-6036 SERGEYEV G. YA. //KERNAERGIE// 00/00/1959 f V0002 N----,, PP 0935-0939 MECHANICAL PROPEATIES OF URAN UM. 14PP SAND-76-6036 SERGEYEV, M. /JIZVESTIYA/l 18/12/1975,V ---- rN---- PP 0003 BETTER LABOR CONDITION~ FOR WOMEN IN THE URALS, FAR NORTH., LABOR RESOURCES IN THE URALS 4. PP JPRS 66644 SERGEYEV M. //PLAN06E YJiOZYAYSTVO// 00/00/1976 V---- N0004 PP 0108-0116 URAL TERRI~6RIAL' SECT'ORIAL ECONOMIC PLANS COORDINATED 11 PP 6UO JPRS L/6169 SERGEYEV, M. //ECON.-EKONOMICHESKAYA GAZETA// 00/04/1977fv ---- IN00161 PP 0009 EVALUATION OF REGIONAL PRODUCTION EFFECTIVENESS 5 PP JPRS 6918? SERGEYEV M. A. //SOVEiSKAYA MEDITSINA// 00/0011971,,VO034t N0001 PP 0135-0138 ALLERGIC DERMATOSES IN 6KERS OF A SYNTHETIC FIBE COMBINE 7 PP AIR /FTD-MT-24-1126-74 SERGEYEVf M. A. I/PRIBOROSTROYENIYE// 00/08/1975pV ---- INOO081 PP 0074-0079 -SELECTION Of CELESTIAL BODIES FOR ASTROCORRECTION IN A NAVIGATION SYSTEM 7 PP JPRS 66501 SERGEYEV, M. A. //IZVESTIYA VUZ PRIBOROSTROYENIYE// 0010011977 V---- N0004t PP 0075-0080 SELECTION 6F CELESTIAL BODIES FOR AZIMUTH DETERMI NATION 7 PP GUO JpRS L/7228 SERGEYEVI* //MORSKOY SBORNIK// 00/0?/1975 V----,#N---- PP 0001-0004 -OCEAN FLEEi IN OUR HOMELAND 8 PP DIA/LN 0106-76 SERGEYEV,f 00000007 2552 00000007 2648 000000033930 000000051323 000GO0074401 000000003153 000000033416 000000074672 000000023079 000000056263 //ZNAMENOSETS11 . 00/07/1976..V---- N0007 PP 0008-0009 ' O EMPHASIS ON INDI IDUAL AND SMALL UNIT FIELD TRAINING 5 PP GUO JPRS L/6563 SERGEYEV, N. 0. //ZNAMENOSETS// 00/07/1976 V----..NO007, PP 0002-0003 W NAVY DAY TICLES, FLT ADM SERGEYEV ON CRUISE TRAINING 5 PP GUO JPRS L/6583 SERGEYEV, P. 1. //SUKHOPUTNYYE VOYSKA KAPI TALI STI CHESKI KH GOSUDARSTV// 00/00/1974 V---- N---- PP 0001-0008 ALSO PP 596-592,'588-599 BOOK DESCRIBES CAPITALIST GROUND FORCES 10 PP JPRS 64607 SERGEYEV V V 7 AI /VY SH 11/08/1973fV---- N0187 Pp 0003 SCIENTISTS EXAMI E TOF K DADASHEV 5 PP COLUMN 1- 6 AIR/FTD-MT-23-0004-75 SERGEY EV V 4 i f/VOY. 0Y NNYYE ZNANIYA// V --- 0010011977 N0002 PP 0040-0041 f ;4 APPLICATION OF GONO;f,CS IN MILITARY FIELD DISCUSSED 5 PP UO JPRS L/7059 SERGEYEV, V. MCON.-EKONOMIKA SOVETSKOY UKRAINY// 00/01119771V-0,0001 PP 0081-0087 4 CEMA PLANNING COORDIN ION SMOOTHER 12 PP -GUO -JPRS L/7173 SER6EYEVf V. A. //SOVETSKOYE ZDRAVOOKHRANENIYE// 00/00/1975, V ---- ING003f Pf 0022-0026 EFFECTIVENESS OF PREVENTIVE CARE SANATORIUMS PROPHYLACTORIUMS 6 PP JPRS 64668 SERGEYEV, V. 1. //TRUDY LENINGRADSKIY INSTITUT AVIATSIONNOGO PRIBOROSTROYNIYA/f 00/00/1973f V---- M0082 PP 0078-0055 -.-OPTIMILIK; SUILT~IN TO[RANCE CONTROL OF RANGE- ONLY RADAR IN COMBINATION WITH A COMPUTR 11 PP GUO COPYRIGHT INFORMATION RFER OTHER REQUEST TO FTD/STINFO AIR /FTD-1005) 1-1226-76 SER6EYEvf V, M, //VESTNIK AKADEMII MEDITSINSKIKH NAUK SSSR// 00/00/1974,V ---- 001h PP 0069-06 4 .-PATHOGENESIS OF HRON1 NONSPECIFIC PNEUMONIA IN ILDREN 1.1 PP JPRS 04188 '\1 000000056415 000000008808 000000003141 000000063976 000000069 230 000000034729 000000056781 000000004530 SERGEYEVO Vo me 000000031893 I/DOKLADY AKADEMIl NAUK SSSR// 00/00/19751V0220IN0005 P 1077-1079 P ~ YELLOW ICLEAND SPAR CR S TAL WHICH TURN BLACK UPON ANEALIN6 AIP SERGEYEVol V. V. 000000062538 //ELEC. -ELEKTROTEMNIKA// 00/06/1976 V ---- IN00061 PP 0001-0006 A PERMANENT AGNE S FOR ELECTRICAL MACHINES AND APPARATUSES 16 PP 6U0 COPYRIGHT INFORMATION REFER OTHER REQUEST TO FTD/STINFO -1437-76 AIR /FTD /I D(RS) I SERGEYEV,, VALENTIN 000000052682 //ZHURNAUST// 00/02/1976fV ---- PNO002 PP 0013-0015 INTERVIEW WITH Yu , MUN~YAN ELEMENTS OF PLAN FULFILLMENT 7 PP GUO JPRS L/5968 SERGEYEVf YE. P. 000000043740 //HYGIENIC AVERAGING OF PARAMETERS OF AIR CONDI TIONING,ON SHIPS TAKING INTO ACCOUNT HEAT RADIATION FROM THE SAFETY ZONE// 00/00/0000 V---- N---- PP O(PZ--0075 iO ~ W HYGIENIC ERA61 OF ARAMETERS OF AIR CONDITIONING ON SHIPS TAKING INTO ACCOUNT HEAT RADIATION FROM THE SAFETY ZONE CSO 834411223B-76 COMPLETE SPECIAL SERGEYEVI YE. P. 000000024707 //GIGIYENA I SANITARIYA// 00/00/1973 V0038 N0007 PP 0012-0016 W W 6 CONTEMPOR Y PR EMS F OCCUPATIONAL HYGIENE, OF SEAMEM AND CERTAIN MEASURES OF THEIR SOLUTION IN ARCTIC NAVIGATION 7 PP CSO: 8344/2515A-75 COMPLETED SPECIAL SERGEYEVf Yu. D. 000000022550 //AXUSTICHESKIYE METODY I SREDSTVA ISSLEDOVANIY A OKEANA: AKUSTICHESKOY KONFERENTSII CHELOVEK I OKEAN// 00/10/19741 V ---- IN0002 f PP 0133-0136 1 1-6 OCTOBER 1974 THE RELATIONSHIP BETWEEN SOUND REFLECTION AND PASSAGE CHARACTERISTICS FOR A PLATE WITH A,THIN VISCOELASTIC LAYER 3 PP JPRS 65760 SER6EYEVI YU. K. 000000047125 //PROBLEMY DALNEGO VOSTOKA// 00/00/1974 V--- fNO002 PP 0106-0111 ; JAPAN AND iHE E ERGY CkISIS NTC 75-12003-10A MICROFICHE LOAN ONLY SERGEYEVr YU. K. 000000073977 //PROBLEMY DALNEGO VOSTOKA// 00/00/1974 V ---- IONO002 PP OIOB-0111 i A JAPAN AND HE ENERGY C ISIS 15 PP ERDA N-74-32405 SERGEYEV~ 1U. K. 000000040046 .//PROBLEMY DALNEGO VOSTOKA// 00/00/1974/ V ---- fNO0021 PP 0108-0111 JAPAN AND ENERGY CRISIS NASA TT F 15924 SERGEYEVA,, G. A. //PROBLEMY DALNEGO VOSTOKA// 00/00/1974,V----IN0003 PP 0177-0181 MAOIST-STYLE PARTY REOkGANIZATION 8 PP JPRS 63409 SERGEYEVA, 1. A. //MECH.-MEKHANIZATSIYA I AVTOMATIZATSIYA PROIZV ODSTVA// 00/00/19?41V ---- ?NOOO?f PP 0020-0021 METAL CUTTING MACHINES WITH DIGITAL PROGRAMMED CONTROL 4~,PP JPRS 63253 SERGEYEVA, L. M. //MAKROMOLEKULY NA 6RANITSE RAZDELA FAZ// ?V----rN---- PP 0073-0078- 00/00/1971 l INVESTIGATION OF THE ASSORPTION OF POLYMERS AND . OUGOMERS ON INORGANIC FILLO-S 8 PP AIR /FTD-ID(RS) I-069W6 SERGEYEVA, L M. //GETEROGENNYYE POLIMERNYYE MATERIALY// 00/00/1973 V---- N---- PP 0096-0102 ' STUDY OF AE ADS GRPTIA OF EPOXIDE RESINS ON FIBER GLASS 13 PP AIR IFTD-ID(RS)1-0698-76 SER6EYEVA,p N. G. I/BIOLOGIYA MORYA// 00/00/19?4,f V00321N---- PP 0022-0042 A QUALITATIVE COMPOSITI AND THE QUANTITATIVE DISTRkBUTION'OF FREE-LIVING NEMATODES ON THE S UT El" 0 ST OF CRIMEA I H ! *NTIS TT 53081 SERGE~EJVN. G. //91 IY A MORYA// ,VO032 N--- PP 0022-0042 00/00/1974 , , QUALITATIVE COw6SITIO N AND THE QUANTITATIVE DISTRIBUTION :OF FREE-LIVING *NTIS IT 77-53081 SERGEYE% N. G. //ZOOLOGICHESKII ZMURNAL// 00/00/19?4,,VO053IN0001, PP 0120-0125 NEW FREE-LIVING NEMATODES (ENOPLIDA) FR OM THE BLACK SEA *NTIS IT 77-53080 SERGEYEVA, N. G. //ZOOLGICHESKII ZHURNAL// 00/00/1974,,VO053,NDOOlf PP 0120-0125 NEW FREE-LIVING NEMATODES (ENOPLIDA) FROM THE BLACK SEA *NTIS IT 77-53080 SERGEYEVA.. I. K. //PHYSIC. -FIZIKO KHIKICHESKAYA MEKHANIKA MATERI ALOV// 00/00/1974fVO010 fNO001 . PP 0091-0092 , . CRITICAL COEFFICIENT OF STRESS CORROSION CRACKING OF HIGH STRENGTH STEEL fie 9 359 SERGEYEVAt V. N. //CHEM.-KNIMIYA DREVESINY// 00/00/1910,v ---- IN006f PP 0053-0060 000000002715 000000037634 000000048552 000000051G72 000000071191 000000069007 000000069M 000000071281 000000037032 000000004030 INVESTIdATION OF WOOD DESTROYED BY ENZYMES I *NTIS TT 74 58041 SERGIENKO I. Z. /fDOKLkR AKADEMII NAUK SSSR// 00/03/1074fVO21510002 Pp 0474-0477 AMINO ACIDS AND CARBOADRATES IN VERY ANCIENT DEPOSITS (FOR, THE EXAMPLE OF THE KYNITE SHALES OF THE KOLA PENINSULA) CB S ER 61 NI V. Y A. //DOKLADY AN SSSR, GEOPHYSICS// .00/00/1974 V0217PNO003f PP 0565-0568 SIMILITAIii OF ANNUAL AND CLIMATIC VARIATIONS GF THE ATMOSPHERIC ZONAL CIRCULATION AGI SERGINI' V. Y A. //MODtltIROVANIE PLANETARNOI SISTEMY LEDNIKI- OKEAN-AT140SFERA// 00/10/119761V ---- IN ---- I Pp 0005-0051 SYSTEM ANALYSIS OF THE PROBLEM OF LARGE-SCALE OSCILLATIONS OF THE CLIMATE AND GLACIATION OF THEIARTH. 60PP UCRL TRANS-11183 SERGIYENKOJ# 1. Z //DOKLADY AKADE;9YA NAUK SSSR// 00/00/1974fVO215 N---- PP 0474-0477 AMINO ACIDS AND ~ARBO40RATES IN VERY ANCIENT DEPOSITS NTC 75!12627-07D SERGIYENKO.. I. Z. //DOKLADY AKADEMII NAUK SSSR/l 00/00/19741VO?15 N0002 PP D474-0477 AMINO ACIDS AND ~ARBOADRATES IN VERY ANCIENT DEPOSIT (ACCORDING TO THE EXAMPLE OF THE CYANITE SCHISTS ON THE KOLA PENINSULA) 9 PP NASA-T,I-F-15829 SERGIY I1ENKO,.S. R. //IZVtSTIYA AN TURKMENSKOI SSR SERIYA FIZIKO- TEKHNICHESKIKH, l